Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53250 34 / 0.0009 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT2G46330 34 / 0.001 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041273 [exp] 66 / 3e-16 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1) Lus10037436 [exp] 59 / 1e-13 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1) Lus10023629 [exp] 59 / 2e-13 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10024263 [exp] 59 / 2e-13 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [poplar] [flax] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Potri.018G078801.1 pacid=42802085 polypeptide=Potri.018G078801.1.p locus=Potri.018G078801 ID=Potri.018G078801.1.v4.1 annot-version=v4.1 ATGAGTTCCATGAGATTGCATGCTCTTCCCATCATTGGCTTCATGTTCTTGGCACTCTTGGAGTTTGGTTTCGGTCAAGGCACGGCTCCTTCCCCTGCAG AAGGCCCAACTAATGATGGCAAGACGATTGATCAAGGAATTGCTTACATCCTTCTCATGCTGGCTCTTGCAATCACATATCTCTTCCATTGA
AA sequence Show only first row Show all	>Potri.018G078801.1 pacid=42802085 polypeptide=Potri.018G078801.1.p locus=Potri.018G078801 ID=Potri.018G078801.1.v4.1 annot-version=v4.1 MSSMRLHALPIIGFMFLALLEFGFGQGTAPSPAEGPTNDGKTIDQGIAYILLMLALAITYLFH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.018G078801 [exp]	0	1
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Potri.009G066100 [exp]	1.73	0.9356	Pt-MPK3.2
AT3G16720		ATL2	TOXICOS EN LEVADURA 2 (.1)		Potri.008G219200 [exp]	2.00	0.9331	ATL2.3
AT5G66210		CPK28	calcium-dependent protein kina...		Potri.005G113600 [exp]	3.87	0.9073	CPK18
AT5G57580			Calmodulin-binding protein (.1...		Potri.011G043300 [exp]	4.24	0.9184	CBP60.12
AT4G17070			peptidyl-prolyl cis-trans isom...		Potri.003G083900 [exp]	8.12	0.8725
AT2G40000		ATHSPRO2	ARABIDOPSIS ORTHOLOG OF SUGAR ...		Potri.010G191300 [exp]	8.94	0.9002
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.001G325100 [exp]	9.00	0.8699	NAC114
AT1G50600	GRAS	SCL5	scarecrow-like 5 (.1)		Potri.011G131100 [exp]	10.77	0.9175
AT5G39670			Calcium-binding EF-hand family...		Potri.004G122900 [exp]	12.00	0.8915
AT2G17705			unknown protein		Potri.005G107700 [exp]	12.24	0.8697

Compare expression of checked genes

Potri.018G078801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.