Potri.018G078900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13227 42 / 3e-06 serine-rich protein-related (.1)
AT1G67910 41 / 5e-06 unknown protein
AT5G55980 41 / 8e-06 serine-rich protein-related (.1)
AT5G20370 40 / 2e-05 serine-rich protein-related (.1)
AT3G56500 39 / 3e-05 serine-rich protein-related (.1)
AT1G52342 39 / 4e-05 unknown protein
AT1G24577 37 / 0.0001 unknown protein
AT5G25280 36 / 0.001 serine-rich protein-related (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G159300 117 / 6e-36 AT1G24577 43 / 5e-07 unknown protein
Potri.001G371400 41 / 2e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
Potri.010G046700 39 / 2e-05 AT1G67910 82 / 4e-22 unknown protein
Potri.008G186200 38 / 8e-05 AT1G67910 85 / 4e-23 unknown protein
Potri.006G060700 38 / 0.0001 AT5G11090 66 / 4e-14 serine-rich protein-related (.1)
Potri.018G079200 37 / 0.0002 AT1G67910 45 / 9e-08 unknown protein
Potri.018G120300 36 / 0.0005 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023630 61 / 1e-13 AT1G67910 44 / 2e-07 unknown protein
Lus10043217 49 / 4e-09 AT1G52342 48 / 7e-09 unknown protein
Lus10034901 41 / 8e-06 AT1G67910 49 / 6e-09 unknown protein
Lus10023632 40 / 2e-05 AT1G67910 48 / 1e-08 unknown protein
Lus10026701 37 / 0.0001 AT1G67910 56 / 5e-12 unknown protein
Lus10006660 38 / 0.0002 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2)
Lus10038100 38 / 0.0002 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2)
Lus10000442 37 / 0.0003 AT1G67910 56 / 1e-11 unknown protein
Lus10008811 37 / 0.0004 AT5G11090 61 / 2e-12 serine-rich protein-related (.1)
Lus10001946 37 / 0.0005 AT5G11090 179 / 9e-57 serine-rich protein-related (.1)
PFAM info
Representative CDS sequence
>Potri.018G078900.1 pacid=42800654 polypeptide=Potri.018G078900.1.p locus=Potri.018G078900 ID=Potri.018G078900.1.v4.1 annot-version=v4.1
ATGTGTCACCCGCCGGGTGTGCCTTGGGTTAGCAGGAACTTGGTGGTGTATCGAAGATGGCTAGTTTTACAAGCGGTGGAGACAGAAACTGGACATGCAC
CGACAGAGGTGGCTGCTACTGGCAGCAGTGCTGTTGCTGGCTCGATAAAGAAGTGTTTGTGTTCTCCCACAAGGCACCCCGGATCCTTCAGGTGCAGGCA
CCACCGTTCTGATTATGTGTGGGGTGGGAGAATAACAAGAAGGAAGCAACCTCCTTGA
AA sequence
>Potri.018G078900.1 pacid=42800654 polypeptide=Potri.018G078900.1.p locus=Potri.018G078900 ID=Potri.018G078900.1.v4.1 annot-version=v4.1
MCHPPGVPWVSRNLVVYRRWLVLQAVETETGHAPTEVAATGSSAVAGSIKKCLCSPTRHPGSFRCRHHRSDYVWGGRITRRKQPP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13227 serine-rich protein-related (.... Potri.018G078900 0 1
AT3G01660 S-adenosyl-L-methionine-depend... Potri.001G340900 5.38 0.9681
AT1G74970 TWN3, RPS9 ribosomal protein S9 (.1) Potri.002G132200 9.59 0.9680 Pt-RPS9.2
AT3G26040 HXXXD-type acyl-transferase fa... Potri.011G124128 12.00 0.9623
AT2G34460 NAD(P)-binding Rossmann-fold s... Potri.011G079600 13.56 0.9526
AT3G22690 unknown protein Potri.013G044700 16.30 0.9586
AT3G08740 elongation factor P (EF-P) fam... Potri.016G136600 17.32 0.9605
AT2G46735 unknown protein Potri.002G178100 18.73 0.9553
AT3G16250 PnsB3, NDF4 Photosynthetic NDH subcomplex... Potri.001G186800 20.44 0.9568
AT1G55140 Ribonuclease III family protei... Potri.001G200300 22.27 0.9516
AT1G06190 Rho termination factor (.1.2) Potri.002G037800 22.62 0.9546

Potri.018G078900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.