Pt-TPX1.1 (Potri.018G083500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TPX1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65980 280 / 3e-98 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT1G65970 271 / 9e-95 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G60740 268 / 2e-93 Thioredoxin superfamily protein (.1)
AT3G52960 191 / 3e-62 Thioredoxin superfamily protein (.1)
AT1G65990 197 / 4e-61 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
AT3G06050 108 / 4e-30 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G423500 320 / 6e-114 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.013G102100 187 / 6e-61 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.019G024000 101 / 3e-27 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015077 279 / 7e-98 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023180 279 / 9e-98 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10023662 277 / 5e-97 AT1G65980 264 / 5e-92 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10003373 188 / 5e-61 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10002843 187 / 1e-60 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10021932 107 / 5e-29 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 95 / 2e-23 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00578 AhpC-TSA AhpC/TSA family
Representative CDS sequence
>Potri.018G083500.1 pacid=42800799 polypeptide=Potri.018G083500.1.p locus=Potri.018G083500 ID=Potri.018G083500.1.v4.1 annot-version=v4.1
ATGGCCCCGATCGCTGTTGGTGATGTCTTGCCTGATGGAAAGCTCGCTTATTTCGACGAGCAAGATCAGCTCCAGGAAGTGTCCGTACACTCTCTAGTTG
CCGGTAAAAAGGTCATCCTCTTTGGTGTTCCCGGTGCCTTCACCCCCACCTGCAGCTTGAAGCATGTGCCGGGGTTTATCGAGAAAGCAGGGGAGTTAAA
ATCAAAGGGCGTTACTGAAATTTTGTGCATCAGCGTCAACGACCCCTTTGTGATGAAGGCATGGGCCAAATCTTACCCTGAGAATAAGCATGTCAAATTC
TTAGCTGATGGGTCTGCAACGTACACCCATGCTCTCGGCCTTGAGCTTGACCTGCAAGAGAAAGGGCTTGGCACACGTTCTAGGAGGTTTGCTCTCTTGG
TTGATGACCTTAAGGTGAAAGCTGCAAATATTGAAGGGGGTGGAGAATTCACTGTGTCCAGTGCCGATGATATCCTCAAGGATCTTTGA
AA sequence
>Potri.018G083500.1 pacid=42800799 polypeptide=Potri.018G083500.1.p locus=Potri.018G083500 ID=Potri.018G083500.1.v4.1 annot-version=v4.1
MAPIAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKAGELKSKGVTEILCISVNDPFVMKAWAKSYPENKHVKF
LADGSATYTHALGLELDLQEKGLGTRSRRFALLVDDLKVKAANIEGGGEFTVSSADDILKDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G65980 TPX1 thioredoxin-dependent peroxida... Potri.018G083500 0 1 Pt-TPX1.1
AT5G20090 Uncharacterised protein family... Potri.012G095133 26.64 0.7446
AT3G02870 VTC4 Inositol monophosphatase famil... Potri.006G014900 33.00 0.7299
AT5G08530 CI51 51 kDa subunit of complex I (.... Potri.010G057400 57.54 0.6799
AT1G67350 unknown protein Potri.003G173000 80.42 0.7157
AT1G51410 NAD(P)-binding Rossmann-fold s... Potri.009G052000 87.89 0.6640 CCRL4
AT2G44360 unknown protein Potri.001G230100 89.48 0.7075
AT5G10460 Haloacid dehalogenase-like hyd... Potri.019G099100 92.73 0.6905
AT3G22480 PDF2 prefoldin 2 (.1.2) Potri.001G240200 111.66 0.6950
AT2G26210 Ankyrin repeat family protein ... Potri.006G217100 141.91 0.6370
AT5G45130 ATRAB-F2A, RHA1... ARABIDOPSIS RAB HOMOLOG F2A, R... Potri.015G113000 153.40 0.6721 ARA7.2

Potri.018G083500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.