Plant FIBer expression Database

Potri.018G083800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28830 331 / 8e-117 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043228
[exp]
352 / 4e-125 AT4G28830 352 / 3e-125 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
Lus10011107
[exp]
348 / 9e-124 AT4G28830 349 / 5e-124 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF05175 MTS Methyltransferase small domain
Representative CDS sequence
>Potri.018G083800.2 pacid=42800587 polypeptide=Potri.018G083800.2.p locus=Potri.018G083800 ID=Potri.018G083800.2.v4.1 annot-version=v4.1
ATGAAGCTGAAGCAATTAGAAAGCATGTTAGGTGAGCTTCAACAGTTCTCCAATCCAAAGGCAGAGCTGGAACAGTACCCAACTGGACCTCACATTGCTT
CTCGTATGCTCTATACCGCAGAAAACTCGTTAGGGGATGTTAGCAACAAGATAGTTGCAGATTTCGGTTGTGGGTGTGGCACATTGGGCGCTGCAGCTTC
TCTTATGGGTGCAGAGCAGGTTATCGGCATCGATATTGATTCTGAATCTCTTGAGATAGCATCTCTAAATGCGGAGGATCTTGAGCTGGACATAAACTTC
ATTCAGTGTGATATCAGGAACTTAGTATGGAGAGGTCCTATTGTTGATACTGTTGTGATGAATCCTCCATTTGGGACCCGAAGGAATGGTGCCGACATGG
ATTTTCTTTCAGCAGCATTAAAGATTGCTTCTCGAGCAGTTTATTCATTACACAAGACCTCAACAAGAGAGCATGTTAAAAAGGCAGCCTTGCGGGGCTT
TGGTGCTAGCAGTGCAGAGGTTTTATGTGAGCTTCGGTTTGATGTGCCTAAGCTATACAAATTTCACAAGAAAAGGGAGATGGACATTGCTGTAGATCTC
TGGCGGTTTGCACCAAAAACCAACCAAGGAAATGATAATTGA
AA sequence
>Potri.018G083800.2 pacid=42800587 polypeptide=Potri.018G083800.2.p locus=Potri.018G083800 ID=Potri.018G083800.2.v4.1 annot-version=v4.1
MKLKQLESMLGELQQFSNPKAELEQYPTGPHIASRMLYTAENSLGDVSNKIVADFGCGCGTLGAAASLMGAEQVIGIDIDSESLEIASLNAEDLELDINF
IQCDIRNLVWRGPIVDTVVMNPPFGTRRNGADMDFLSAALKIASRAVYSLHKTSTREHVKKAALRGFGASSAEVLCELRFDVPKLYKFHKKREMDIAVDL
WRFAPKTNQGNDN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G28830 S-adenosyl-L-methionine-depend... Potri.018G083800
[exp]
0 1
AT4G21790 ATTOM1, TOM1 tobamovirus multiplication 1 (... Potri.011G001000
[exp]
3.87 0.8030 TOM1.1
AT2G30000 PHF5-like protein (.1) Potri.001G277700
[exp]
4.24 0.8239
AT1G36380 unknown protein Potri.002G090100
[exp]
5.47 0.8327
AT3G44160 Outer membrane OMP85 family pr... Potri.009G017100
[exp]
7.48 0.7929
AT4G02840 Small nuclear ribonucleoprotei... Potri.005G207900
[exp]
7.74 0.7847
AT4G02485 2-oxoglutarate (2OG) and Fe(II... Potri.014G131200
[exp]
7.87 0.7518
AT5G14250 CSN3, FUS11, CO... FUSCA 11, COP9 SIGNALOSOME SUB... Potri.017G066300
[exp]
10.00 0.8178
AT5G19830 Peptidyl-tRNA hydrolase family... Potri.001G005000
[exp]
18.76 0.7889
AT1G29810 Transcriptional coactivator/pt... Potri.011G078900
[exp]
18.76 0.7794
AT1G15780 unknown protein Potri.003G025200
[exp]
18.97 0.7611

Potri.018G083800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.