Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-LJRH102.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28850 403 / 1e-142 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1) AT5G57550 301 / 8e-103 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G25810 298 / 2e-101 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 295 / 2e-100 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57530 292 / 4e-99 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G57540 285 / 4e-96 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT4G25820 283 / 2e-95 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1) AT3G23730 281 / 1e-94 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 278 / 2e-93 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G30270 277 / 2e-93 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G160700 [exp] 550 / 0 AT4G28850 390 / 9e-138 xyloglucan endotransglucosylase/hydrolase 26 (.1) Potri.006G170001 [exp] 304 / 8e-104 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G169900 [exp] 304 / 8e-104 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170100 [exp] 304 / 8e-104 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094800 [exp] 304 / 9e-104 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.002G060500 [exp] 301 / 3e-102 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 298 / 2e-101 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.018G095200 [exp] 292 / 3e-99 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.005G201200 [exp] 293 / 4e-99 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011112 [exp] 489 / 1e-176 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10012978 [exp] 454 / 1e-162 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10043232 [exp] 344 / 7e-119 AT4G28850 241 / 3e-78 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10010938 [exp] 306 / 1e-104 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10010939 [exp] 306 / 2e-104 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 305 / 4e-104 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 303 / 2e-103 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10003048 [exp] 293 / 2e-99 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 291 / 8e-99 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 289 / 7e-98 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.018G084300.1 pacid=42801465 polypeptide=Potri.018G084300.1.p locus=Potri.018G084300 ID=Potri.018G084300.1.v4.1 annot-version=v4.1 ATGGCAAGTTTACGAGCTTCCCTGGTAGCTCTATTCATCTTTGCAGTGGCATTTGATCCAAGTTCAGTTAATGCCAAATTCTCCAAGAGCATGTATTTCT ATTGGGGTGCCCGTCATTCGTCAATACTTGGCAATGGCGACGATCTTCAACTTGTCTTGAATCAGTCGTCAGGCTCTGGTGTTAAATCGAAGCGTCCGTT CCTATTTGGAAGCATTCAAATGTTAATTAAGCTGGTACCTGGGAACTCAGCTGGAACTGTCACTGCCTATTACGTATCCTCTTCTGGGGACAGACACGAC GAAATAGACTTCGAGTTCTTAGGGAATACATCTGGACAGCCATACACCATACACACAAACATCTACACTCAAGGAAATGGAAGCAGGGAACAGCAATTCC GCCCCTGGTTTGACCCAACTGCAGATTTCCATAATTACACTATACATTGGAACCCTACTGAAGTTGTGTGGTACATTGATAATGTACCAATCCGCGTATA CCGTAACTATGAAAATGAGGGGATTGCTTACCCAAACAAACAGGGAATGAGGGTCTACTCCAGCTTGTGGAATGCTGATAACTGGGCAACTCAAGGTGGG CGAGTTAAGATTGATTGGACAGTGGCACCCTTCATAGCAAGATACCGCAATTTTAGGGCAAGGGCTTGCAAGTGGAATGGACCAGTTAGCATAAATCAAT GTGCTGCCAAGACCCCAGCGAACTGGTGGACATCCCCCGCCTATAGCAAGTTGAGCAATGCCCAATTGGATCAAATGAAGCGGGTCAGAGACAACTACAT GATCTACAACTACTGCAATGACACTAAGAGGTTCAATGGACAAATGCCACCTGAATGTTTTAAGGCGCAGTTCTAA
AA sequence Show only first row Show all	>Potri.018G084300.1 pacid=42801465 polypeptide=Potri.018G084300.1.p locus=Potri.018G084300 ID=Potri.018G084300.1.v4.1 annot-version=v4.1 MASLRASLVALFIFAVAFDPSSVNAKFSKSMYFYWGARHSSILGNGDDLQLVLNQSSGSGVKSKRPFLFGSIQMLIKLVPGNSAGTVTAYYVSSSGDRHD EIDFEFLGNTSGQPYTIHTNIYTQGNGSREQQFRPWFDPTADFHNYTIHWNPTEVVWYIDNVPIRVYRNYENEGIAYPNKQGMRVYSSLWNADNWATQGG RVKIDWTVAPFIARYRNFRARACKWNGPVSINQCAAKTPANWWTSPAYSKLSNAQLDQMKRVRDNYMIYNYCNDTKRFNGQMPPECFKAQF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Potri.018G084300 [exp]	0	1	Pt-LJRH102.2
AT5G17250			Alkaline-phosphatase-like fami...		Potri.003G059300 [exp]	15.29	0.6381
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Potri.010G159300 [exp]	15.93	0.6788	GRF12.1
AT5G60580			RING/U-box superfamily protein...		Potri.016G022900 [exp]	19.97	0.6518
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Potri.001G032800 [exp]	40.12	0.5918
AT5G56350			Pyruvate kinase family protein...		Potri.003G223100 [exp]	91.92	0.5540
AT3G13930			Dihydrolipoamide acetyltransfe...		Potri.001G198000 [exp]	123.64	0.5262
AT2G47960			unknown protein		Potri.004G040500 [exp]	226.68	0.5202
AT2G45850	AT-hook		AT hook motif DNA-binding fami...		Potri.009G150000 [exp]	250.95	0.5134

Compare expression of checked genes

Potri.018G084300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.