Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35190 451 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 409 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 340 / 5e-117 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 320 / 7e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 290 / 4e-97 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 243 / 2e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G50210 133 / 4e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 128 / 3e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G49620 127 / 1e-33 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 119 / 2e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086900 [exp] 548 / 0 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G079600 [exp] 305 / 5e-103 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 144 / 4e-40 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.004G146000 [exp] 117 / 7e-30 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 114 / 8e-29 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G033600 [exp] 107 / 2e-26 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.010G096800 [exp] 106 / 5e-26 AT4G21200 362 / 8e-125 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.010G201000 [exp] 103 / 7e-25 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G247700 [exp] 101 / 2e-24 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034964 [exp] 525 / 0 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10012963 [exp] 524 / 0 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 461 / 2e-164 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 447 / 3e-158 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 299 / 2e-100 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 234 / 4e-75 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 127 / 1e-33 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011476 [exp] 111 / 1e-27 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10029081 [exp] 106 / 7e-26 AT4G21200 365 / 3e-126 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10030995 [exp] 105 / 2e-25 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.018G086800.1 pacid=42800417 polypeptide=Potri.018G086800.1.p locus=Potri.018G086800 ID=Potri.018G086800.1.v4.1 annot-version=v4.1 ATGGAGAAAAAGCAGTCTGGTACTGGTAATGCTACGGGTCCTGCTACTAAGGAAGTCTCCTTCCTCAATCGCATCGATCTTTCCAGTCCCGATATTCACC AATCTGTTTCTCTTCTCAAACAGGCATGTTTGGATTGTGGATTTTTTTACGTGATCAATCATGGGATGAGTGAAGAATTGATGGAGGAGGTATTTGAGCA AAACAAGAAATTTTTCGAGTTGCCATTAAGTGAGAAAATGAAAGTTTTAAGGAACGAGAAGCATAGAGGCTACACTCCTCTTTTTGATGAGCTCCTGGAT CCTGATAATCAAGTTCATGGAGATTATAAGGAGGGTTATTACATTGGAGTTGAAGTGCCTGAAGATGATCCTAAAGCTGAGAAGCCATTTTATGGGCCCA ATGTTTGGCCTTCAGATGATATTTTGCCTGGTTGGAGGCACACTATGGAGAAGTATTACCCAGAGGCATTAGAAGTAGCAAGAGCCATTGTAAGGATCAT AGCACTTGCACTTGATCTGGAGGCTGATTTCTTTGATAAGCCAGAAATTCTTGGCCAGCCACTTGTGTTATTGCGATTGCTAAAGTATCCAGGTCAGATT TCTGATCCCTCAAATGGATTATATGGAGCTGGAGCACATACTGATTATGGTCTCATTACCCTCTTAGCTACAGATGATGTTTATGGCCTCCAAATATGCA AGGATAAAGATGCTCAACCTCGAGTATGGGAATTCATAGCACCATTGAAAGGAGCATTCATAGTGAATCTTGGTGACATGCTGGAACGCTGGAGCAACTG TCTTTTCAAGTCCACGCTGCACAGAGTTTTAGGGAATGGTCAAGAGCGATATTCTATTGCTTATTTTGTGGAACCTAGTTATGACTGTCTTGTCGAATGC TTGCCAACCTGCAAGTCCGAGAAAAATCCACCCAAGTTTCCTCCAGTCATATATGGGGATTACCTTGGTCAACGCTACAAGGATACTCATATTGATCTGA ATGTGTACAACAAACTGCAGAGTTGA
AA sequence Show only first row Show all	>Potri.018G086800.1 pacid=42800417 polypeptide=Potri.018G086800.1.p locus=Potri.018G086800 ID=Potri.018G086800.1.v4.1 annot-version=v4.1 MEKKQSGTGNATGPATKEVSFLNRIDLSSPDIHQSVSLLKQACLDCGFFYVINHGMSEELMEEVFEQNKKFFELPLSEKMKVLRNEKHRGYTPLFDELLD PDNQVHGDYKEGYYIGVEVPEDDPKAEKPFYGPNVWPSDDILPGWRHTMEKYYPEALEVARAIVRIIALALDLEADFFDKPEILGQPLVLLRLLKYPGQI SDPSNGLYGAGAHTDYGLITLLATDDVYGLQICKDKDAQPRVWEFIAPLKGAFIVNLGDMLERWSNCLFKSTLHRVLGNGQERYSIAYFVEPSYDCLVEC LPTCKSEKNPPKFPPVIYGDYLGQRYKDTHIDLNVYNKLQS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Potri.018G086800 [exp]	0	1
AT2G37195			unknown protein		Potri.006G127800 [exp]	4.58	0.7664
AT1G20460			unknown protein		Potri.002G013000 [exp]	7.74	0.7295
AT4G13720			Inosine triphosphate pyrophosp...		Potri.001G052400 [exp]	7.93	0.7372
AT5G37680		ATARLA1A	ADP-ribosylation factor-like A...		Potri.017G130500 [exp]	12.00	0.6838
AT1G30845			unknown protein		Potri.005G235800 [exp]	12.72	0.7402
AT1G61780			postsynaptic protein-related (...		Potri.004G021200 [exp]	13.03	0.7307
AT2G39570		ACR9	ACT domain repeats 9, ACT doma...		Potri.001G237100 [exp]	18.97	0.7009
AT5G18250			unknown protein		Potri.001G023000 [exp]	20.00	0.7106
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Potri.013G110450 [exp]	22.04	0.6817
AT1G72175			RING/U-box protein with domain...		Potri.019G078800 [exp]	22.62	0.6995

Compare expression of checked genes

Potri.018G086800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.