Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35190 478 / 8e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G46490 431 / 3e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46480 367 / 7e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 337 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16770 291 / 3e-97 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16765 239 / 5e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 126 / 3e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G50210 125 / 4e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G49630 122 / 5e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G49620 121 / 2e-31 DIN11 DARK INDUCIBLE 11, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G086800 [exp] 551 / 0 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G079600 [exp] 298 / 2e-100 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 131 / 2e-35 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.004G146100 [exp] 125 / 9e-33 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 122 / 1e-31 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 107 / 1e-26 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G150300 [exp] 103 / 6e-25 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G355200 [exp] 103 / 9e-25 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1) Potri.018G033600 [exp] 101 / 3e-24 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012963 [exp] 570 / 0 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10034964 [exp] 568 / 0 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011126 [exp] 478 / 3e-171 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10043026 [exp] 462 / 6e-164 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004746 [exp] 280 / 4e-93 AT4G16770 370 / 7e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10007820 [exp] 216 / 3e-68 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021002 [exp] 131 / 4e-35 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 108 / 6e-27 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011476 [exp] 105 / 3e-25 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10020999 [exp] 103 / 1e-24 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.018G086900.1 pacid=42801847 polypeptide=Potri.018G086900.1.p locus=Potri.018G086900 ID=Potri.018G086900.1.v4.1 annot-version=v4.1 ATGGAGAATATGCCGAAGCAGGATGATACTCCCGAGCCTACAACAATTTCCTTCCTTAATTGCATCGATCTTTCAACCCCTGATGTCCAGCAATCTGTTT CCCTTCTCAAACAGGCGTGTTTGGATTGTGGATTTTTTTACGTGACAAATCACGGGATAAGCCAAGAATTCATGGAGGAGGTGTTTTCGCAGAGTAAGAA ATTTTTTGAATTGCCATTGAGTGAGAAAATGAAGGTTTTAAGGAATGAGAAGCATAGGGGTTATACTCCTGTTCTGGATGAGCTCTTGGATCCTGATAAT CAAATTCATGTAGGAGACTATAAGGAGGGGTATTACATTGGAGTTGAAGTCCCTGAAGATGATCCTGAAGCTGACAAACCTTTTTATGGGCCCAATGTCT GGCCTGCAGATGGTATTTTGCCTGGATGGAGGCAGACTATGGAGAAGTTTCATCAACAAGCACTAGGGGTGGCTAGAGCAGTAGCTAGGATCATAGCACT TGCGCTTGATCTGGAGGCTGATTTCTTTGATAAGCCAGAAATGCTTGGACATCCAATTGCAGTCATGCGTTTGCTGCACTATGCAGGTCAGATTTCCGAT CCCTCAAAAGGATTATATGGGGCTGGAGCACATTCTGATTATGGTCTGATTACCCTCTTAGCCACTGATAATGTTTATGGCCTCCAAATATGCAAGGATA AAGATGCTCAACCTCAAGTATGGGAATTTGTAGCACCATTGAAGGGAGCATTTGTAGTGAATCTTGGTGACATGCTGGAGCGCTGGAGCAACTGTATTTT CAAGTCCACCTTGCACAGAGTTTTAGGGAATGGTCAAGAGCGATATTCTATTGCCTATTTTGTGGAACCCAGTCATGAATGTCTCGTGGAATGCTTGCCA ACCTGCAAGTCAGAAAAAAACCCCCCCAAGTTTCCTCCTATCAAATGTGAGGCTTACCTTAGCCAACGCTACAAGGACACTCATGCTGATCTGAAAGTAT ACAACAAACATTAA
AA sequence Show only first row Show all	>Potri.018G086900.1 pacid=42801847 polypeptide=Potri.018G086900.1.p locus=Potri.018G086900 ID=Potri.018G086900.1.v4.1 annot-version=v4.1 MENMPKQDDTPEPTTISFLNCIDLSTPDVQQSVSLLKQACLDCGFFYVTNHGISQEFMEEVFSQSKKFFELPLSEKMKVLRNEKHRGYTPVLDELLDPDN QIHVGDYKEGYYIGVEVPEDDPEADKPFYGPNVWPADGILPGWRQTMEKFHQQALGVARAVARIIALALDLEADFFDKPEMLGHPIAVMRLLHYAGQISD PSKGLYGAGAHSDYGLITLLATDNVYGLQICKDKDAQPQVWEFVAPLKGAFVVNLGDMLERWSNCIFKSTLHRVLGNGQERYSIAYFVEPSHECLVECLP TCKSEKNPPKFPPIKCEAYLSQRYKDTHADLKVYNKH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Potri.018G086900 [exp]	0	1
AT1G13580		LOH3, LAG13	LAG One Homologue 3, LAG1 long...		Potri.015G055000 [exp]	2.82	0.9142
AT1G16670			Protein kinase superfamily pro...		Potri.001G438400 [exp]	3.46	0.9149
AT1G06800		PLA-I{gamma}1	phospholipase A I gamma 1, alp...		Potri.005G218500 [exp]	4.47	0.8924
AT2G15730			P-loop containing nucleoside t...		Potri.014G034300 [exp]	5.19	0.8971
AT4G28300			Protein of unknown function (D...		Potri.013G131600 [exp]	6.00	0.8768
AT2G15760			Protein of unknown function (D...		Potri.004G143500 [exp]	7.07	0.8919
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Potri.006G105300 [exp]	9.79	0.8867
AT5G53050			alpha/beta-Hydrolases superfam...		Potri.015G011300 [exp]	10.04	0.7818
AT3G09010			Protein kinase superfamily pro...		Potri.004G040200 [exp]	10.77	0.8343
AT4G31780		UGT81A1, EMB279...	UDP-glycosyl transferase 81A1,...		Potri.006G266500 [exp]	11.61	0.8537

Compare expression of checked genes

Potri.018G086900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.