Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25930 227 / 2e-69 Protein kinase family protein with leucine-rich repeat domain (.1) AT4G28650 163 / 1e-46 Leucine-rich repeat transmembrane protein kinase family protein (.1) AT1G08590 154 / 8e-44 Leucine-rich receptor-like protein kinase family protein (.1) AT4G28490 152 / 3e-43 RLK5, HAESA RECEPTOR-LIKE PROTEIN KINASE 5, HAESA, Leucine-rich receptor-like protein kinase family protein (.1) AT5G65700 149 / 5e-42 BAM1 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2) AT3G49670 148 / 1e-41 BAM2 BARELY ANY MERISTEM 2, Leucine-rich receptor-like protein kinase family protein (.1) AT2G33170 148 / 2e-41 Leucine-rich repeat receptor-like protein kinase family protein (.1) AT1G17230 148 / 2e-41 Leucine-rich receptor-like protein kinase family protein (.1) AT5G61480 146 / 5e-41 PXY, TDR TDIF receptor, PHLOEM INTERCALATED WITH XYLEM, Leucine-rich repeat protein kinase family protein (.1) AT4G20270 144 / 2e-40 BAM3 BARELY ANY MERISTEM 3, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G088062 [exp] 367 / 2e-122 AT5G25930 949 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.018G088100 [exp] 365 / 2e-121 AT5G25930 949 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.018G088200 [exp] 296 / 7e-95 AT5G25930 885 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.006G235450 [exp] 241 / 6e-82 AT5G25930 268 / 9e-84 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.018G057100 [exp] 245 / 5e-76 AT5G25930 1034 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.006G235800 [exp] 243 / 3e-75 AT5G25930 1074 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Potri.002G256500 [exp] 164 / 4e-47 AT4G28650 1339 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1) Potri.019G021700 [exp] 162 / 2e-46 AT1G08590 1286 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.004G049100 [exp] 161 / 5e-46 AT1G28440 1387 / 0.0 HAESA-like 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034978 [exp] 229 / 5e-70 AT5G25930 927 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10012949 [exp] 228 / 5e-70 AT5G25930 910 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10005491 [exp] 228 / 1e-69 AT5G25930 1104 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10006028 [exp] 228 / 1e-69 AT5G25930 1116 / 0.0 Protein kinase family protein with leucine-rich repeat domain (.1) Lus10003503 [exp] 153 / 6e-47 AT1G72180 278 / 2e-87 Leucine-rich receptor-like protein kinase family protein (.1) Lus10038382 [exp] 160 / 9e-47 AT4G20270 734 / 0.0 BARELY ANY MERISTEM 3, Leucine-rich receptor-like protein kinase family protein (.1) Lus10027951 [exp] 163 / 1e-46 AT1G08590 1256 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10000814 [exp] 162 / 1e-46 AT1G08590 1263 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10025943 [exp] 162 / 3e-46 AT4G28650 1284 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10036242 [exp] 162 / 3e-46 AT4G20270 1248 / 0.0 BARELY ANY MERISTEM 3, Leucine-rich receptor-like protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.018G088086.1 pacid=42801438 polypeptide=Potri.018G088086.1.p locus=Potri.018G088086 ID=Potri.018G088086.1.v4.1 annot-version=v4.1 ATGCACCATGACTGCTCTCCTCCCATAGTACACCGAGATGTCAAGTCAAGCAATATACTGTTGGATTCTGAGTTCAACGCAAAAATCGCTGATTTTGGTT TAGCAAGGATGCTTGTTAAGCAGGGAGAACTTGCTACTGTGTCTGCTGTGGCTGGTTCTTTGGGTTACATAGCTCCAGAGTATGCTCGAACAGTTAGAGT GAATGAGAAGATTGATGTTTATAGCTTTGGAGTTGTCCTTCTTGAACTAACGACAGGGAAAGCAGCTAATTATGGTGACGAGGATACATGCCTTGCCGAA TGGGCATGGCGTCACATGCAAGAAGGAAAACCTATAGTCGATGTGTTAGATGAGGAGATAAAGGAGCCTTGTTACGTGGATGAGATGAGAGATGTTTTCA AACTAGGGGTGTTCTGTACGAGCATGTTGCCTTCAGAAAGGCCTAACATGAAGGACGTTGTCCAAATCTTACTTGGTAGGAACCGTCGATGGGTCTGTGG AAGGAAGAATATGAGACATGCATGA
AA sequence Show only first row Show all	>Potri.018G088086.1 pacid=42801438 polypeptide=Potri.018G088086.1.p locus=Potri.018G088086 ID=Potri.018G088086.1.v4.1 annot-version=v4.1 MHHDCSPPIVHRDVKSSNILLDSEFNAKIADFGLARMLVKQGELATVSAVAGSLGYIAPEYARTVRVNEKIDVYSFGVVLLELTTGKAANYGDEDTCLAE WAWRHMQEGKPIVDVLDEEIKEPCYVDEMRDVFKLGVFCTSMLPSERPNMKDVVQILLGRNRRWVCGRKNMRHA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G25930			Protein kinase family protein ...		Potri.018G088086 [exp]	0	1
					Potri.010G053902 [exp]	3.87	0.7321
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G016700 [exp]	10.77	0.6348
					Potri.005G181150 [exp]	12.24	0.5928
AT1G75790		SKS18	SKU5 similar 18 (.1)		Potri.002G021000 [exp]	15.49	0.5552
					Potri.014G181301 [exp]	16.24	0.6596
AT5G25930			Protein kinase family protein ...		Potri.018G088100 [exp]	17.74	0.6261
					Potri.004G099433 [exp]	24.00	0.6253
					Potri.005G064250 [exp]	38.01	0.5465
AT5G25930			Protein kinase family protein ...		Potri.018G088062 [exp]	42.80	0.6053
AT3G62930			Thioredoxin superfamily protei...		Potri.014G134000 [exp]	87.94	0.5068

Compare expression of checked genes

Potri.018G088086 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.