Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57420 141 / 6e-43 AUX_IAA IAA33 indole-3-acetic acid inducible 33 (.1) AT4G28640 54 / 4e-09 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT1G04550 53 / 1e-08 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G65670 51 / 6e-08 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT2G33310 50 / 1e-07 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT4G29080 49 / 3e-07 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT1G04100 49 / 3e-07 AUX_IAA IAA10 indoleacetic acid-induced protein 10 (.1) AT3G23050 49 / 4e-07 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT1G04250 48 / 8e-07 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT3G04730 47 / 1e-06 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G166900 [exp] 262 / 8e-91 AT5G57420 149 / 5e-46 indole-3-acetic acid inducible 33 (.1) Potri.008G172400 [exp] 56 / 1e-09 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.001G190300 [exp] 54 / 8e-09 AT3G16500 235 / 3e-76 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.003G048100 [exp] 52 / 3e-08 AT3G16500 224 / 4e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.018G057000 [exp] 50 / 1e-07 AT3G16500 192 / 3e-59 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.006G236200 [exp] 50 / 1e-07 AT3G16500 184 / 3e-56 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.013G041300 [exp] 49 / 1e-07 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.014G111700 [exp] 49 / 2e-07 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.010G065200 [exp] 49 / 2e-07 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042929 [exp] 50 / 2e-07 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10028222 [exp] 50 / 2e-07 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10007193 [exp] 49 / 2e-07 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10019241 [exp] 49 / 5e-07 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10022868 [exp] 48 / 7e-07 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10010081 [exp] 47 / 8e-07 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10014731 [exp] 48 / 9e-07 AT3G04730 241 / 4e-80 indoleacetic acid-induced protein 16 (.1) Lus10014464 [exp] 48 / 1e-06 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10009967 [exp] 47 / 1e-06 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10025817 [exp] 47 / 2e-06 AT3G16500 231 / 1e-74 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.018G092300.1 pacid=42801357 polypeptide=Potri.018G092300.1.p locus=Potri.018G092300 ID=Potri.018G092300.1.v4.1 annot-version=v4.1 ATGAACAGTAGTTTTGATTCTAAAAAAAGAGAAGACTCCTTGAAAGGAAGATGGCAAGAGATTAGAAGAGTCCCAAACATGAGCCAGTACACTCGACCAA CTTCTTCTGTACCCAACTTCATGGCTAAGCCTATAACCTTCCCTGGCTTTGAAGATGACGATGTTGTTTCCACCATGATCCCTCCGGTGACAGTTGCTCT CGAGGGCCGTTCGATCTGCCAGAGAATTAGCCTTCATAAGCATGAAAGCTATCATAGCCTTGCAAAGGCTCTAAGGCAGATGTTTGTTGATGGAGCTGGC AGCGATTCAGGACAGAACACATCATCAGCATCAGATAGTGTTAGTGATCTTGATCTTGATCTTTCAAATGCGATTCCTGGTCATCTCATTGCCTATGAAG ACATTGAAAATGATCTCCTTCTTGCCGGTGACCTTAACTGGCAAGATTTTGTGCGTGTGGCCAAGAGGATTAGGATACTGCCCGCAAAGGGGAATTCAAG GAAGGCAACAGGAGGGACGGCTGTGTGA
AA sequence Show only first row Show all	>Potri.018G092300.1 pacid=42801357 polypeptide=Potri.018G092300.1.p locus=Potri.018G092300 ID=Potri.018G092300.1.v4.1 annot-version=v4.1 MNSSFDSKKREDSLKGRWQEIRRVPNMSQYTRPTSSVPNFMAKPITFPGFEDDDVVSTMIPPVTVALEGRSICQRISLHKHESYHSLAKALRQMFVDGAG SDSGQNTSSASDSVSDLDLDLSNAIPGHLIAYEDIENDLLLAGDLNWQDFVRVAKRIRILPAKGNSRKATGGTAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57420	AUX_IAA	IAA33	indole-3-acetic acid inducible...		Potri.018G092300 [exp]	0	1
AT2G17080			Arabidopsis protein of unknown...		Potri.002G012400 [exp]	1.41	0.9281
AT2G27140			HSP20-like chaperones superfam...		Potri.009G153100 [exp]	2.82	0.9112
AT5G06710	HD	HAT14	homeobox from Arabidopsis thal...		Potri.018G133100 [exp]	3.00	0.8878
AT4G00820		IQD17	IQ-domain 17 (.1)		Potri.011G153400 [exp]	4.24	0.8541
					Potri.001G388450 [exp]	5.29	0.8846
					Potri.009G152101 [exp]	8.48	0.8473
AT4G27870			Vacuolar iron transporter (VIT...		Potri.001G127900 [exp]	9.16	0.8489
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Potri.001G457000 [exp]	10.72	0.8579	Pt-HMGR3.1
AT1G19020			unknown protein		Potri.015G070700 [exp]	21.42	0.7960
AT2G17080			Arabidopsis protein of unknown...		Potri.005G248975 [exp]	22.64	0.7890

Compare expression of checked genes

Potri.018G092300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.