Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57510 107 / 4e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G273566 [exp] 92 / 3e-25 AT5G57510 75 / 4e-18 unknown protein Potri.006G273500 [exp] 92 / 3e-25 AT5G57510 75 / 4e-18 unknown protein Potri.018G006800 [exp] 84 / 8e-22 AT5G57510 61 / 1e-12 unknown protein Potri.003G217500 [exp] 41 / 9e-06 ND / Potri.001G008160 [exp] 37 / 0.0004 AT2G26110 45 / 7e-07 Protein of unknown function (DUF761) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028472 [exp] 96 / 4e-26 AT5G57510 87 / 1e-22 unknown protein Lus10033559 [exp] 93 / 3e-25 AT5G57510 84 / 1e-21 unknown protein Lus10026228 [exp] 89 / 2e-23 AT5G57510 62 / 6e-13 unknown protein Lus10017598 [exp] 88 / 4e-23 AT5G57510 80 / 6e-20 unknown protein Lus10009171 [exp] 84 / 2e-21 AT5G57510 88 / 6e-23 unknown protein Lus10042441 [exp] 83 / 3e-21 AT5G57510 64 / 9e-14 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05553 [poplar] [flax] DUF761 Cotton fibre expressed protein
Representative CDS sequence Show only first row Show all	>Potri.018G094100.1 pacid=42800837 polypeptide=Potri.018G094100.1.p locus=Potri.018G094100 ID=Potri.018G094100.1.v4.1 annot-version=v4.1 ATGGGCAGGGACAAGTGGTCATTGCTTAGCCGCTTAACGAGGGCAATCAAGAAGGTAAAGATCATACTAAATCTTGATATGAGTCGTTGGCGTCTGGCTT CTATGATTGGTGCTGCATCCTCGAGGAGACACCAGCTTAGCTTTAATGATAGACCAGGGCTAAGGGGCTGGGAAGATATTGATGATGAAGAATCAGAAGA CCCGGGTTCTTCAAAGGGGCTACATAGAACCATCAGCTATCAATCAGAAGATGATATTGATAAGAGAGCTGAAATGTTTATTGAAAATTTCCGTCGCCAA CTTCAGATTGAGAGGCAGATTTCCTTGGAGCTCAAGTATTTCCAAGGTTTAAATAGCTTCAAATCGATTTCTCCATGA
AA sequence Show only first row Show all	>Potri.018G094100.1 pacid=42800837 polypeptide=Potri.018G094100.1.p locus=Potri.018G094100 ID=Potri.018G094100.1.v4.1 annot-version=v4.1 MGRDKWSLLSRLTRAIKKVKIILNLDMSRWRLASMIGAASSRRHQLSFNDRPGLRGWEDIDDEESEDPGSSKGLHRTISYQSEDDIDKRAEMFIENFRRQ LQIERQISLELKYFQGLNSFKSISP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57510			unknown protein		Potri.018G094100 [exp]	0	1
AT4G18540			unknown protein		Potri.011G064300 [exp]	2.23	0.9953
AT4G37760		SQE3	squalene epoxidase 3 (.1)		Potri.012G121320 [exp]	2.44	0.9946
AT3G61510		AT-ACS1, ACS1	ARABIDOPSIS THALIANA 1-AMINOCY...		Potri.002G163700 [exp]	3.87	0.9940	Pt-ACS1.3
AT2G41380			S-adenosyl-L-methionine-depend...		Potri.006G042200 [exp]	5.29	0.9917
AT5G36160			Tyrosine transaminase family p...		Potri.017G014200 [exp]	5.47	0.9935
AT2G45760		BAL, BAP2	BON ASSOCIATION PROTEIN 1-LIKE...		Potri.014G078600 [exp]	16.55	0.9384
					Potri.011G112350 [exp]	28.00	0.9903
AT2G46550			unknown protein		Potri.007G097400 [exp]	29.03	0.9373
AT1G35210			unknown protein		Potri.005G161700 [exp]	30.16	0.9896
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Potri.006G055600 [exp]	30.88	0.9902	Pt-ZOG1.15

Compare expression of checked genes

Potri.018G094100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.