Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25810 411 / 6e-146 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 409 / 5e-145 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 406 / 5e-144 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT4G30270 390 / 5e-138 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT2G18800 389 / 7e-137 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1) AT5G48070 379 / 2e-133 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT5G57530 358 / 5e-125 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT4G14130 356 / 4e-124 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT5G57540 355 / 4e-124 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT4G30280 355 / 9e-124 XTH18, ATXTH18 xyloglucan endotransglucosylase/hydrolase 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G095100 [exp] 441 / 1e-157 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 436 / 6e-156 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.013G005700 [exp] 426 / 5e-151 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094800 [exp] 421 / 1e-149 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.005G007200 [exp] 414 / 6e-147 AT4G25810 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.014G146100 [exp] 386 / 5e-136 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.002G060500 [exp] 384 / 5e-135 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.006G071200 [exp] 383 / 9e-135 AT4G25810 379 / 3e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.002G060400 [exp] 382 / 1e-134 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030484 [exp] 368 / 1e-128 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Lus10021638 [exp] 365 / 1e-127 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10000678 [exp] 364 / 2e-127 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10028947 [exp] 361 / 2e-126 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10020773 [exp] 351 / 5e-122 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 350 / 9e-122 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10007349 [exp] 348 / 3e-121 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 348 / 4e-121 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020772 [exp] 348 / 6e-121 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 346 / 2e-120 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.018G094900.1 pacid=42801819 polypeptide=Potri.018G094900.1.p locus=Potri.018G094900 ID=Potri.018G094900.1.v4.1 annot-version=v4.1 ATGGCTGCCTACCCTTCTGAGCCAAACCCTTTACTACTGCTGCTAATGATCTCTCTTCTGGTTGGTTCTGATTTGTTGTTGGTTGACGCTGGTTCCTTTT ACCAAGATGTTGATATCATATGGGGAGACGGACGAGCTAAAATACTCAACAATGGCAATCTTCTAACACTTTCCCTTGACAGAGCATCTGGCTCAGGGTT CCAATCCAAGAATGAGTATTTCTTTGGCAAGTTTGATATCCAACTCAAGCTTGTCCCTGGCAACTCTGCTGGCACTGTCACTACTTTCTATCTACACTCA CAAGGGTCAGCATGGGATGAGATTGACTTTGAGTTTTTGGGCAATTTGAGTGGTGATCCTTACTTAGTCCATACTAATGTGTACACTCAAGGAAAAGGTG ACAGAGAGCAACAATTCTACCTCTGGTTTGATCCAACAGCTGATTTTCATACCTATTCAGTCCTCTGGAATCCAAGACATATTGTATTCTATGTTGACGG GAGACCAATAAGGGAATTCAAAAACATGGAATCAATTGGAGTCCCATACCCCAAAAGGCAATCAATGAGGATGTATGCAAGCATATGGAATGCAGATGAC TGGGCTACAAGAGGGGGCCTTGTGAAGACAGACTGGACTCAAGCTCCCTTTACCGTTTCATATAGAAACTTCAATGCCGAAGCTTGTATGGGGTCTAATG GAGTCTCTTCTTGCAATAACTCAACTAATAACCGGTGGTACTCTCAAGAGCTGGATTCTACAAGTCAAAAACAGCTGAAATGGGTGCGGGAGAATTATAT GGTTTACAATTACTGTGCAGACACTAAGCGATTCCCTCAGGGCCTCCCTCTTGAATGCAATGCCACCAAGAAGTAG
AA sequence Show only first row Show all	>Potri.018G094900.1 pacid=42801819 polypeptide=Potri.018G094900.1.p locus=Potri.018G094900 ID=Potri.018G094900.1.v4.1 annot-version=v4.1 MAAYPSEPNPLLLLLMISLLVGSDLLLVDAGSFYQDVDIIWGDGRAKILNNGNLLTLSLDRASGSGFQSKNEYFFGKFDIQLKLVPGNSAGTVTTFYLHS QGSAWDEIDFEFLGNLSGDPYLVHTNVYTQGKGDREQQFYLWFDPTADFHTYSVLWNPRHIVFYVDGRPIREFKNMESIGVPYPKRQSMRMYASIWNADD WATRGGLVKTDWTQAPFTVSYRNFNAEACMGSNGVSSCNNSTNNRWYSQELDSTSQKQLKWVRENYMVYNYCADTKRFPQGLPLECNATKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.018G094900 [exp]	0	1
AT3G16030		CES101	CALLUS EXPRESSION OF RBCS 101,...		Potri.001G441400 [exp]	6.00	0.8621
AT4G21920			unknown protein		Potri.004G015900 [exp]	9.94	0.8576
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014356 [exp]	11.48	0.8407
AT4G27220			NB-ARC domain-containing disea...		Potri.019G014336 [exp]	13.41	0.8283
AT1G65840		ATPAO4	polyamine oxidase 4 (.1)		Potri.017G144001 [exp]	14.14	0.8127
AT2G16900			Arabidopsis phospholipase-like...		Potri.004G176100 [exp]	14.83	0.8381
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.005G201250 [exp]	21.44	0.7825
AT5G16220			Octicosapeptide/Phox/Bem1p fam...		Potri.004G095600 [exp]	27.92	0.8037
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Potri.002G183200 [exp]	30.85	0.8334
AT3G22910			ATPase E1-E2 type family prote...		Potri.008G159100 [exp]	32.18	0.7948	ACA13.1

Compare expression of checked genes

Potri.018G094900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.