Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11650 182 / 6e-58 ATOSM34 osmotin 34 (.1) AT1G77700 105 / 3e-27 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75030 101 / 1e-26 ATLP-3 thaumatin-like protein 3 (.1) AT1G75050 101 / 1e-26 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75800 102 / 4e-26 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75040 94 / 8e-24 PR-5, PR5 pathogenesis-related gene 5 (.1) AT1G18250 92 / 4e-23 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G19320 92 / 6e-23 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38660 92 / 3e-22 Pathogenesis-related thaumatin superfamily protein (.1.2) AT2G17860 90 / 4e-22 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G102400 [exp] 173 / 1e-54 AT4G11650 360 / 2e-127 osmotin 34 (.1) Potri.001G107600 [exp] 170 / 2e-53 AT4G11650 356 / 1e-125 osmotin 34 (.1) Potri.001G107800 [exp] 164 / 2e-51 AT4G11650 291 / 1e-100 osmotin 34 (.1) Potri.001G107950 [exp] 164 / 2e-51 AT4G11650 287 / 6e-99 osmotin 34 (.1) Potri.005G173900 [exp] 97 / 9e-25 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1) Potri.002G087100 [exp] 95 / 9e-24 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G112600 [exp] 95 / 1e-23 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.001G220900 [exp] 92 / 3e-23 AT1G20030 251 / 2e-83 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.004G014574 [exp] 92 / 4e-23 AT1G75800 294 / 8e-100 Pathogenesis-related thaumatin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024511 [exp] 172 / 1e-53 AT4G11650 315 / 5e-109 osmotin 34 (.1) Lus10006302 [exp] 162 / 3e-50 AT4G11650 294 / 3e-101 osmotin 34 (.1) Lus10006690 [exp] 152 / 3e-46 AT4G11650 292 / 1e-100 osmotin 34 (.1) Lus10007034 [exp] 151 / 6e-46 AT4G11650 293 / 5e-101 osmotin 34 (.1) Lus10017170 [exp] 142 / 1e-42 AT4G11650 251 / 2e-84 osmotin 34 (.1) Lus10023897 [exp] 99 / 1e-25 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1) Lus10005140 [exp] 98 / 1e-25 AT4G11650 117 / 6e-33 osmotin 34 (.1) Lus10025629 [exp] 100 / 3e-25 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1) Lus10028447 [exp] 97 / 3e-24 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10041899 [exp] 96 / 1e-23 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [poplar] [flax] CDC PF00314 [poplar] [flax] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Potri.018G096070.1 pacid=42801346 polypeptide=Potri.018G096070.1.p locus=Potri.018G096070 ID=Potri.018G096070.1.v4.1 annot-version=v4.1 ATGGACCATCACCGCGAGGGCCGGAACAACACAAGCCCGTATTTGGGGACGGCCAAGTGCAATTTCAATGGGGCTGGGCGAGGGACGTGTGAGACAGGTG ATTGCAATGGGCTCTTGCAATGCCAAGCCTTCGGGAAACCCCCTAACACACTGGCTGAATATGCCTTGAACCAATTCAACAACTTAGATTTCTTTGACAT ATCTCTTGTTGATGGGTTTAATGTTCCTATGGACTTCAGTCCAGTATCAGGCAACTGCCGCGGAATTAGGTGCGCAGCTGATATCAATGGACAGTGCCCA AATCCGCTCAGGGCCAGCGGAGGGTGCAACAATCCTTGCACTGTCTTCAAGACAGATCAATACTGTTGCAATTCTGGCACTGTAGCCCAACAAATTACTC TAGGTTTTTCAAGCAGAGGTGCCCTGACGCTTATAGTTATCCTAAAGATGACCAAACAAGCACCTTCACCTGTCCCGGTGGAACTAATTACAGGGTTGTA TTCTGCCCTTGAAGCAGTTTTAAGCCAGGATTTAATGGTGTAA
AA sequence Show only first row Show all	>Potri.018G096070.1 pacid=42801346 polypeptide=Potri.018G096070.1.p locus=Potri.018G096070 ID=Potri.018G096070.1.v4.1 annot-version=v4.1 MDHHREGRNNTSPYLGTAKCNFNGAGRGTCETGDCNGLLQCQAFGKPPNTLAEYALNQFNNLDFFDISLVDGFNVPMDFSPVSGNCRGIRCAADINGQCP NPLRASGGCNNPCTVFKTDQYCCNSGTVAQQITLGFSSRGALTLIVILKMTKQAPSPVPVELITGLYSALEAVLSQDLMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.018G096070 [exp]	0	1
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.018G096063 [exp]	1.00	0.9939
AT5G25620		YUC6	YUCCA6, Flavin-binding monooxy...		Potri.007G028200 [exp]	9.53	0.9386	FML8
AT1G24260	MADS	AGL9, SEP3	SEPALLATA3, AGAMOUS-like 9, K-...		Potri.003G169600 [exp]	14.07	0.9038
					Potri.018G115601 [exp]	17.49	0.9505
AT5G23730		EFO2, RUP2	REPRESSOR OF UV-B PHOTOMORPHOG...		Potri.015G143200 [exp]	20.04	0.9118
AT1G23710			Protein of unknown function (D...		Potri.018G096400 [exp]	24.69	0.9140
AT1G32780			GroES-like zinc-binding dehydr...		Potri.011G152900 [exp]	28.91	0.9299
AT4G31980			unknown protein		Potri.003G206201 [exp]	33.46	0.9386
AT1G54870			NAD(P)-binding Rossmann-fold s...		Potri.010G092400 [exp]	33.85	0.9401
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Potri.001G058900 [exp]	37.54	0.9345

Compare expression of checked genes

Potri.018G096070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.