Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64830 84 / 1e-19 Eukaryotic aspartyl protease family protein (.1) AT5G33340 81 / 2e-18 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT2G35615 61 / 2e-11 Eukaryotic aspartyl protease family protein (.1) AT1G31450 52 / 3e-08 Eukaryotic aspartyl protease family protein (.1) AT2G23945 46 / 2e-06 Eukaryotic aspartyl protease family protein (.1) AT3G59080 39 / 0.001 Eukaryotic aspartyl protease family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G105300 [exp] 85 / 7e-20 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.014G114400 [exp] 82 / 1e-18 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G087900 [exp] 77 / 5e-17 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.001G020400 [exp] 44 / 2e-05 AT2G03200 127 / 3e-32 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 39 / 0.001 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024910 [exp] 73 / 2e-15 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024903 [exp] 72 / 3e-15 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 72 / 4e-15 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041151 [exp] 69 / 6e-14 AT5G33340 445 / 1e-154 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10037254 [exp] 66 / 3e-13 AT2G35615 392 / 1e-133 Eukaryotic aspartyl protease family protein (.1) Lus10002611 [exp] 66 / 4e-13 AT5G33340 392 / 9e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10023445 [exp] 66 / 5e-13 AT5G33340 448 / 9e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10035668 [exp] 64 / 2e-12 AT2G35615 385 / 1e-130 Eukaryotic aspartyl protease family protein (.1) Lus10040325 [exp] 62 / 7e-12 AT5G33340 451 / 5e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10018825 [exp] 62 / 9e-12 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [poplar] [flax] Peptidase_AA PF14541 [poplar] [flax] TAXi_C Xylanase inhibitor C-terminal
Representative CDS sequence Show only first row Show all	>Potri.018G097801.1 pacid=42801138 polypeptide=Potri.018G097801.1.p locus=Potri.018G097801 ID=Potri.018G097801.1.v4.1 annot-version=v4.1 ATGGGCTCGGTTGGACGAGGAGGTAGGCCTTCGTCACTTACCTCTCGAATTGGATCTTATTCAGGGAACATAAAGTTCACTCACTGCTTGGTTCCATTCC ATAGCACTCTGAATATTTCAAGCAAGATGTATTCCGGTGATGGAAGTGAGATTATCGGTAAGGGTGTGGTGTCAACTCCTTTGGTTCGAAAAAAAAACCG GGCCTATTATTATGTCGCTTTGGAAGGAATAAGTGTTAGAGGGAAGTTCTTGACTTATAGCTCATCGGGCACAATTTCTAAAGGTAATGTATTCAGTGAC ACAGCCACACCGCCAACAATATTACCTAAAGATTTCTACAATCGGTTGGAACAAGAAGTGAAGAACTCAATTCCGGTGACACCGTATCGAGATTCACAGC TAAGGACACAACTTTGTTATAGAGGCAATACTACTACTATTAATGCCCCCTATATTAACAGTCCATTTTGA
AA sequence Show only first row Show all	>Potri.018G097801.1 pacid=42801138 polypeptide=Potri.018G097801.1.p locus=Potri.018G097801 ID=Potri.018G097801.1.v4.1 annot-version=v4.1 MGSVGRGGRPSSLTSRIGSYSGNIKFTHCLVPFHSTLNISSKMYSGDGSEIIGKGVVSTPLVRKKNRAYYYVALEGISVRGKFLTYSSSGTISKGNVFSD TATPPTILPKDFYNRLEQEVKNSIPVTPYRDSQLRTQLCYRGNTTTINAPYINSPF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G64830			Eukaryotic aspartyl protease f...		Potri.018G097801 [exp]	0	1
					Potri.004G089450 [exp]	5.29	0.6189
AT1G58440		SQE1, XF1	SQUALENE EPOXIDASE 1, FAD/NAD(...		Potri.015G120900 [exp]	9.89	0.6293
AT1G33055			unknown protein		Potri.011G149400 [exp]	16.88	0.6338
					Potri.012G116401 [exp]	23.64	0.6095
					Potri.007G065950 [exp]	38.34	0.5784
AT1G32560		AtLEA4-1	Late Embryogenesis Abundant 4-...		Potri.003G090501 [exp]	69.64	0.5826
					Potri.018G119450 [exp]	71.20	0.5848
AT1G43760			DNAse I-like superfamily prote...		Potri.010G033133 [exp]	163.07	0.5063
AT5G66520			Tetratricopeptide repeat (TPR)...		Potri.006G231200 [exp]	171.33	0.5455
AT2G25890			Oleosin family protein (.1)		Potri.018G057800 [exp]	206.05	0.5022

Compare expression of checked genes

Potri.018G097801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.