Potri.018G098000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18670 87 / 9e-22 RING/U-box superfamily protein (.1)
AT4G30370 84 / 1e-20 RING/U-box superfamily protein (.1)
AT2G42360 65 / 6e-13 RING/U-box superfamily protein (.1)
AT2G44578 61 / 4e-12 RING/U-box superfamily protein (.1)
AT3G20395 62 / 6e-12 RING/U-box superfamily protein (.1)
AT1G74410 61 / 1e-11 RING/U-box superfamily protein (.1)
AT2G27940 61 / 1e-11 RING/U-box superfamily protein (.1)
AT2G44581 59 / 1e-11 RING/U-box superfamily protein (.1)
AT4G35840 59 / 6e-11 RING/U-box superfamily protein (.1)
AT5G66070 58 / 2e-10 RING/U-box superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098100 196 / 8e-65 AT2G18670 91 / 2e-23 RING/U-box superfamily protein (.1)
Potri.006G175700 170 / 4e-54 AT2G18670 91 / 1e-22 RING/U-box superfamily protein (.1)
Potri.001G235100 61 / 6e-12 AT1G04360 98 / 3e-24 RING/U-box superfamily protein (.1)
Potri.005G108200 60 / 2e-11 AT4G35840 369 / 7e-131 RING/U-box superfamily protein (.1)
Potri.005G244500 59 / 5e-11 AT5G42200 149 / 3e-46 RING/U-box superfamily protein (.1)
Potri.007G061400 59 / 7e-11 AT2G17730 351 / 8e-124 NEP-interacting protein 2 (.1.2)
Potri.010G010500 59 / 8e-11 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.008G054200 57 / 1e-10 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1)
Potri.002G017400 57 / 1e-10 AT5G42200 154 / 2e-48 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019979 100 / 8e-27 AT2G18670 113 / 5e-32 RING/U-box superfamily protein (.1)
Lus10015506 94 / 1e-24 AT2G18670 102 / 2e-28 RING/U-box superfamily protein (.1)
Lus10022223 66 / 3e-13 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10008797 64 / 1e-12 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10028406 62 / 5e-12 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10041859 62 / 5e-12 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10016163 62 / 6e-12 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10021524 61 / 2e-11 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10001654 59 / 8e-11 AT1G74410 251 / 1e-84 RING/U-box superfamily protein (.1)
Lus10021628 59 / 1e-10 AT1G74410 250 / 5e-84 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.018G098000.1 pacid=42800774 polypeptide=Potri.018G098000.1.p locus=Potri.018G098000 ID=Potri.018G098000.1.v4.1 annot-version=v4.1
ATGTCTCCTCCTCCTCATCACCACGGTGGTGCACCACCAAAACCAAACCGGAAGTTTATTTTTCTTGTCCTGAAAGCCATAGTAATGATCGCAATAACCA
TCCTTTTTTTCGTACTCCTTGGTGTTGCCGCCATCCTCCTCCTCATTCCCACCGCCGCACTCCACCGCCACTCGACTCCATCCTCCAATCCCCCAAAGGG
GTTGCCTCTCAAAGACTTAAAGAAGCTCCCGAGATTCAGATTCTCGACTAAGACGACACCTGAAACGGCTGCTGATCAAAGTTCATGTGTGGTTTGTCTT
GAAGATATAAAGCAAGGGCAGTGGTGTAGAAACCTTGTTGGCTGTGGTCATGTCTTGCATATGAAATGTGTGGATAGTTGGCTTGTTAAGGTTTCTGCGT
GTCCTATTTGCAGGACAAGAGTTGAATTTGATCAAGGCGTAAAAGATAGGCCATCGTGGGACTTTGTTTGGAAAAATGAATTGAATATTGGTAGAATTTT
CTCTTTCTTTTTCTAA
AA sequence
>Potri.018G098000.1 pacid=42800774 polypeptide=Potri.018G098000.1.p locus=Potri.018G098000 ID=Potri.018G098000.1.v4.1 annot-version=v4.1
MSPPPHHHGGAPPKPNRKFIFLVLKAIVMIAITILFFVLLGVAAILLLIPTAALHRHSTPSSNPPKGLPLKDLKKLPRFRFSTKTTPETAADQSSCVVCL
EDIKQGQWCRNLVGCGHVLHMKCVDSWLVKVSACPICRTRVEFDQGVKDRPSWDFVWKNELNIGRIFSFFF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18670 RING/U-box superfamily protein... Potri.018G098000 0 1
Potri.014G185516 19.69 0.6644
Potri.008G224291 29.66 0.6615
Potri.008G225301 33.68 0.6595
Potri.008G224192 38.80 0.6584
Potri.008G224501 40.03 0.6578
AT5G47550 Cystatin/monellin superfamily ... Potri.006G014500 41.98 0.6314 Pt-API.1
Potri.008G224255 45.39 0.6555
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Potri.001G342200 50.39 0.5431
Potri.008G224273 56.55 0.6524
Potri.018G115200 59.28 0.6480

Potri.018G098000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.