Potri.018G098100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18670 91 / 3e-23 RING/U-box superfamily protein (.1)
AT4G30370 85 / 5e-21 RING/U-box superfamily protein (.1)
AT5G41400 62 / 2e-12 RING/U-box superfamily protein (.1)
AT2G42360 62 / 6e-12 RING/U-box superfamily protein (.1)
AT4G09100 59 / 1e-11 RING/U-box superfamily protein (.1)
AT1G74410 60 / 3e-11 RING/U-box superfamily protein (.1)
AT2G44578 59 / 3e-11 RING/U-box superfamily protein (.1)
AT2G42350 59 / 8e-11 RING/U-box superfamily protein (.1)
AT3G16720 59 / 1e-10 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT3G20395 58 / 1e-10 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098000 223 / 2e-75 AT2G18670 87 / 6e-22 RING/U-box superfamily protein (.1)
Potri.006G175700 218 / 5e-73 AT2G18670 91 / 1e-22 RING/U-box superfamily protein (.1)
Potri.001G235100 66 / 1e-13 AT1G04360 98 / 3e-24 RING/U-box superfamily protein (.1)
Potri.014G043200 60 / 8e-12 AT3G60966 76 / 4e-18 RING/U-box superfamily protein (.1)
Potri.010G010500 61 / 2e-11 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.019G130100 59 / 3e-11 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.008G165900 59 / 8e-11 AT1G04360 312 / 2e-104 RING/U-box superfamily protein (.1)
Potri.008G054200 58 / 9e-11 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1)
Potri.002G153400 58 / 1e-10 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019979 132 / 1e-39 AT2G18670 113 / 5e-32 RING/U-box superfamily protein (.1)
Lus10015506 115 / 1e-33 AT2G18670 102 / 2e-28 RING/U-box superfamily protein (.1)
Lus10022223 67 / 6e-14 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10008797 66 / 2e-13 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10016163 61 / 2e-11 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10027736 59 / 2e-11 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1)
Lus10021524 61 / 3e-11 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10041859 60 / 3e-11 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10028406 60 / 3e-11 AT4G35840 371 / 6e-132 RING/U-box superfamily protein (.1)
Lus10002194 58 / 1e-10 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.018G098100.1 pacid=42801001 polypeptide=Potri.018G098100.1.p locus=Potri.018G098100 ID=Potri.018G098100.1.v4.1 annot-version=v4.1
ATGCCTCCTCCTCACCACCACCATGATCACCACCGTACACACGGTGGAGCACCACCAAAACCAAACCAAGAGTTTCTTTCTTTAATCCTGAAAGCCATAA
TAATGACTGCAATAACCATCTTTTTTTTCTTATTCCTTGGCGTTGCCGCCATCCTCCTCCTCTTTGCCACCTCCGCACTCCACCGCCACTCGACTACATC
CTCCAATTCCCCGAAGGCGTTGCCTCTCAAAGAATTAAAGAAGCTCCCAAGATTCAGATTTTCGACTAAGACGAGACCCGAAACGGGTGCTGATCAAAGT
TCATGTGTGGTTTGTCTTGAAGAGATAAAGCAAGGGCAGTGGTGTCGAAACCTTGTTGGCTGTGGTCATGTGTTTCATAGGAAATGTGTGGATGCGTGGC
TTGTCAAGGTTTCTGCATGTCCTATTTGCAGGACGCGAGTTGAATTGGATCAGGGCGTAAAAGATAGGCCATTGTGGGACTTTGTTTGGAGAAATGAATT
GAGGGTTTGGTAG
AA sequence
>Potri.018G098100.1 pacid=42801001 polypeptide=Potri.018G098100.1.p locus=Potri.018G098100 ID=Potri.018G098100.1.v4.1 annot-version=v4.1
MPPPHHHHDHHRTHGGAPPKPNQEFLSLILKAIIMTAITIFFFLFLGVAAILLLFATSALHRHSTTSSNSPKALPLKELKKLPRFRFSTKTRPETGADQS
SCVVCLEEIKQGQWCRNLVGCGHVFHRKCVDAWLVKVSACPICRTRVELDQGVKDRPLWDFVWRNELRVW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18670 RING/U-box superfamily protein... Potri.018G098100 0 1
AT4G35870 early-responsive to dehydratio... Potri.007G063700 3.16 0.7520
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Potri.014G196200 14.83 0.7778
AT3G55830 EPC1 ECTOPICALLY PARTING CELLS, Nuc... Potri.008G065800 20.97 0.7512
AT1G06320 unknown protein Potri.005G202500 23.87 0.7450
AT3G54040 PAR1 protein (.1) Potri.006G094300 32.58 0.7579
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Potri.001G262900 50.91 0.6399
AT2G19570 DESZ, AT-CDA1, ... cytidine deaminase 1 (.1) Potri.006G150600 50.98 0.7340 CDA1.1
AT5G55150 Protein of unknown function (D... Potri.003G127700 53.18 0.6955
AT5G58375 Methyltransferase-related prot... Potri.019G127900 67.82 0.6786
Potri.019G129820 70.53 0.7281

Potri.018G098100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.