Potri.018G098200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 122 / 4e-37 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 78 / 3e-19 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT5G39310 48 / 3e-07 ATHEXPALPHA1.19, ATEXP24, ATEXPA24 EXPANSIN 24, expansin A24 (.1)
AT5G39260 47 / 5e-07 ATHEXPALPHA1.20, ATEXP21, ATEXPA21 EXPANSIN 21, expansin A21 (.1)
AT2G45110 45 / 4e-06 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT1G69530 44 / 4e-06 ATHEXPALPHA1.2, AT-EXP1, ATEXP1, ATEXPA1, EXP1 EXPANSIN 1, expansin A1 (.1.2.3.4.5)
AT5G39270 43 / 2e-05 ATHEXPALPHA1.15, ATEXP22, ATEXPA22 EXPANSIN 22, expansin A22 (.1)
AT5G39290 42 / 2e-05 ATHEXPALPHA1.16, ATEXP26 EXPANSIN 26, expansin A26 (.1)
AT2G40610 42 / 2e-05 ATHEXPALPHA1.11, ATEXP8, ATEXPA8 expansin A8 (.1)
AT5G39280 42 / 5e-05 ATEXP23, ATHEXPALPHA1.17, ATEXPA23 EXPANSIN 23, expansin A23 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G176300 135 / 3e-42 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.003G218300 127 / 8e-39 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.006G179300 108 / 1e-31 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 105 / 3e-30 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.018G029100 94 / 2e-25 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200 92 / 6e-25 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.006G249500 79 / 2e-19 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 77 / 5e-19 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G155000 66 / 2e-14 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019978 118 / 4e-35 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10042435 113 / 7e-33 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232 111 / 4e-32 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10031759 91 / 4e-24 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10030078 85 / 1e-21 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10031760 74 / 2e-18 AT4G30380 72 / 1e-17 Barwin-related endoglucanase (.1)
Lus10013118 76 / 3e-18 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10020131 66 / 4e-14 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1)
Lus10042436 63 / 5e-14 AT2G18660 53 / 2e-10 plant natriuretic peptide A (.1)
Lus10026931 66 / 7e-14 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Potri.018G098200.1 pacid=42801590 polypeptide=Potri.018G098200.1.p locus=Potri.018G098200 ID=Potri.018G098200.1.v4.1 annot-version=v4.1
ATGGCAACTGCTACCCGTGTGTTGTTTTTTATGGGGCTTGTCATCAGCCTGGTCTCAGTAGCTTCTGCCATTTCCGGGACTGCCACTTACTACAACGTTT
ATGTTCCATCTGCATGCTATGGATACCAAGATCAGGGTGTGATGATAGCGGCTGCAAGCGATGGACTTTGGGACAATGGTGCTGCATGCGGGAGAATGTA
CAAGGTGACCTGCCAAGGTCCTACAAACGCCGGTGTTCCTCAGCCCTGCAAAGATGGCAGCGTCACTGTCAAGATTGTTGATCGATGCCCATCACCCGGA
TGTCAAGCAACCATTGATCTCTCTCAAGAAGCCTTCTCTCAGATTGCTGACCTTAACGCTGGAAAAATTAACATTGATTACACCCAAGTTTGA
AA sequence
>Potri.018G098200.1 pacid=42801590 polypeptide=Potri.018G098200.1.p locus=Potri.018G098200 ID=Potri.018G098200.1.v4.1 annot-version=v4.1
MATATRVLFFMGLVISLVSVASAISGTATYYNVYVPSACYGYQDQGVMIAAASDGLWDNGAACGRMYKVTCQGPTNAGVPQPCKDGSVTVKIVDRCPSPG
CQATIDLSQEAFSQIADLNAGKINIDYTQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G30380 EXLB2 Barwin-related endoglucanase (... Potri.018G098200 0 1
AT5G16340 AMP-dependent synthetase and l... Potri.019G068100 2.44 0.9015
AT1G75800 Pathogenesis-related thaumatin... Potri.001G221900 5.74 0.8861
AT5G24090 ATCHIA chitinase A (.1) Potri.015G023900 7.87 0.8893 CHI3.7
AT3G47800 Galactose mutarotase-like supe... Potri.017G080200 7.93 0.8577
AT2G17500 Auxin efflux carrier family pr... Potri.005G099300 10.00 0.8630
Potri.001G388900 11.09 0.7702
AT2G34930 disease resistance family prot... Potri.010G107000 14.45 0.8166
AT5G54630 C2H2ZnF zinc finger protein-related (.... Potri.011G131300 22.73 0.8351
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Potri.009G083300 24.73 0.8170
AT5G24530 DMR6 DOWNY MILDEW RESISTANT 6, 2-ox... Potri.012G006300 29.94 0.8063

Potri.018G098200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.