Plant FIBer expression Database

Potri.018G099201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002419
[exp]
38 / 9e-05 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
PFAM info
Representative CDS sequence
>Potri.018G099201.1 pacid=42800465 polypeptide=Potri.018G099201.1.p locus=Potri.018G099201 ID=Potri.018G099201.1.v4.1 annot-version=v4.1
ATGAGAAAACGTTCTTGCAAATGGAGAAAGATGAAAAGGCCGAAACTCTCATCAATCAGGAACAACCCTAGGAGTACTGCTAGAGTTTCCATGCGGAAGA
AACTGCATCAGCTCCACAAGATCATTCCAGGCTGTGAAGTTATGGACAATATGGAAACTTTATTCCAAATGACTGCAAACTACATCTTTGCACTGCAACT
TAAAGCGAGCTTTCTCCAGAGTTTATGTGTTTTCTATGATGTCTAA
AA sequence
>Potri.018G099201.1 pacid=42800465 polypeptide=Potri.018G099201.1.p locus=Potri.018G099201 ID=Potri.018G099201.1.v4.1 annot-version=v4.1
MRKRSCKWRKMKRPKLSSIRNNPRSTARVSMRKKLHQLHKIIPGCEVMDNMETLFQMTANYIFALQLKASFLQSLCVFYDV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Potri.018G099201
[exp]
0 1
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Potri.005G084500
[exp]
4.24 0.9441
AT5G20950 Glycosyl hydrolase family prot... Potri.013G055700
[exp]
4.47 0.9407
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Potri.009G101700
[exp]
5.00 0.9201 CYP707.4
AT3G50390 Transducin/WD40 repeat-like su... Potri.006G239600
[exp]
6.16 0.9448
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Potri.001G227300
[exp]
9.21 0.9390
AT5G45670 GDSL-like Lipase/Acylhydrolase... Potri.011G076400
[exp]
9.32 0.9414
AT1G29450 SAUR-like auxin-responsive pro... Potri.004G181400
[exp]
14.38 0.9322
AT5G66800 unknown protein Potri.007G042600
[exp]
17.34 0.9014
AT2G27240 Aluminium activated malate tra... Potri.001G217200
[exp]
17.97 0.9261
AT3G21090 ABCG15 ATP-binding cassette G15, ABC-... Potri.009G051300
[exp]
21.97 0.9224

Potri.018G099201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.