Potri.018G099601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30420 67 / 2e-13 nodulin MtN21 /EamA-like transporter family protein (.1)
AT4G28040 46 / 3e-06 nodulin MtN21 /EamA-like transporter family protein (.1.2.3.4.5)
AT2G39510 44 / 2e-05 nodulin MtN21 /EamA-like transporter family protein (.1)
AT1G75500 44 / 3e-05 WAT1 Walls Are Thin 1 (.1.2)
AT3G30340 42 / 6e-05 nodulin MtN21 /EamA-like transporter family protein (.1)
AT3G53210 42 / 8e-05 nodulin MtN21 /EamA-like transporter family protein (.1)
AT4G08290 41 / 0.0002 nodulin MtN21 /EamA-like transporter family protein (.1.2)
AT2G37460 40 / 0.0003 nodulin MtN21 /EamA-like transporter family protein (.1)
AT2G37450 40 / 0.0005 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G177800 150 / 2e-44 AT4G30420 320 / 2e-107 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.006G177700 87 / 9e-21 AT4G30420 353 / 1e-120 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.018G099500 68 / 7e-14 AT4G30420 402 / 7e-140 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.006G177600 64 / 3e-12 AT4G30420 375 / 4e-129 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.010G209200 48 / 1e-06 AT2G39510 503 / 3e-179 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.008G051500 47 / 2e-06 AT2G39510 472 / 4e-167 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.006G033500 45 / 7e-06 AT5G07050 474 / 5e-167 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.016G031400 45 / 1e-05 AT5G07050 504 / 4e-179 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.008G165600 44 / 2e-05 AT5G07050 281 / 4e-92 nodulin MtN21 /EamA-like transporter family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023432 54 / 8e-09 AT2G39510 480 / 2e-170 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10029465 54 / 9e-09 AT2G39510 456 / 1e-160 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10005965 54 / 1e-08 AT2G39510 465 / 2e-164 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10040311 53 / 2e-08 AT2G39510 482 / 2e-171 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10023211 50 / 2e-07 AT4G30420 378 / 1e-130 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10019969 49 / 3e-07 AT4G28040 334 / 8e-114 nodulin MtN21 /EamA-like transporter family protein (.1.2.3.4.5)
Lus10019970 47 / 2e-06 AT4G30420 351 / 5e-120 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10021201 41 / 0.0002 AT1G21890 186 / 3e-56 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10027251 41 / 0.0003 AT3G18200 493 / 2e-175 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Lus10024301 39 / 0.0009 AT1G75500 575 / 0.0 Walls Are Thin 1 (.1.2)
PFAM info
Representative CDS sequence
>Potri.018G099601.1 pacid=42800383 polypeptide=Potri.018G099601.1.p locus=Potri.018G099601 ID=Potri.018G099601.1.v4.1 annot-version=v4.1
ATGTCCATGGCACTGCTCAAAGGACCAGAACTGCTTAACACAGAACTTCTACCAGTAAAATCTTCCAGTACTGGTTCTGGAAGCAAGACTTGGTTGTTGG
GTTCAATAACCCTCTTTGGAAACAGTTGTTCAATTGTAATCTGGAAGATCATGCAGCATCATTATTCTTCAAACCTGGTGCATTGCACAAAGGGGACTAC
ACTTCTTAGCAATGTTCAAACCTCTGCCACCGTTATTGGGACCGTCTTAGCTGCTACCTTTCTACATGAGGTGATCTACACGTCAAGCTTGTTAGGTGCT
ATTGTTGTGATTTCTGGTTTGTATATGGTGATATCGGGTCAAGCTTCAGACCAACAGGAGATCAAACAAGAGACAAATTTTGTGCCACAAGCTGACGGGA
GAAATATTCAGCAAGGTTCTATGGATGAATCTTCAGGACATAACATCTGTAAAAAACATTTGGAAGAGCCACTTCTATATGAAAAACTCCCTAATGTAGA
CAAAGTGTGA
AA sequence
>Potri.018G099601.1 pacid=42800383 polypeptide=Potri.018G099601.1.p locus=Potri.018G099601 ID=Potri.018G099601.1.v4.1 annot-version=v4.1
MSMALLKGPELLNTELLPVKSSSTGSGSKTWLLGSITLFGNSCSIVIWKIMQHHYSSNLVHCTKGTTLLSNVQTSATVIGTVLAATFLHEVIYTSSLLGA
IVVISGLYMVISGQASDQQEIKQETNFVPQADGRNIQQGSMDESSGHNICKKHLEEPLLYEKLPNVDKV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.018G099601 0 1
Potri.006G157801 1.00 0.9774
AT3G21230 4CL5 4-coumarate:CoA ligase 5 (.1) Potri.005G227800 6.70 0.7421
AT1G65352 Putative membrane lipoprotein ... Potri.005G044333 8.12 0.8430
Potri.002G050150 12.40 0.7204
AT5G28780 PIF1 helicase (.1) Potri.008G203701 27.78 0.8516
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Potri.014G114400 29.05 0.6799
AT1G54850 HSP20-like chaperones superfam... Potri.013G024750 59.69 0.6034
AT1G71250 GDSL-like Lipase/Acylhydrolase... Potri.019G067600 71.23 0.6913
AT1G28590 GDSL-like Lipase/Acylhydrolase... Potri.013G015200 84.14 0.6605
Potri.011G106900 163.09 0.6220

Potri.018G099601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.