Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57815 147 / 2e-48 Cytochrome c oxidase, subunit Vib family protein (.1) AT1G22450 149 / 1e-47 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) AT4G28060 144 / 4e-47 Cytochrome c oxidase, subunit Vib family protein (.1) AT1G32710 68 / 4e-16 Cytochrome c oxidase, subunit Vib family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G162100 [exp] 151 / 3e-48 AT1G22450 152 / 4e-47 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) Potri.002G100000 [exp] 115 / 5e-34 AT1G22450 123 / 2e-35 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036478 [exp] 148 / 2e-48 AT1G22450 146 / 2e-46 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) Lus10008716 [exp] 150 / 8e-48 AT1G22450 173 / 4e-55 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) Lus10010345 [exp] 146 / 1e-47 AT1G22450 142 / 4e-46 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) Lus10040123 [exp] 120 / 7e-37 AT1G22450 121 / 9e-36 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1) Lus10020941 [exp] 112 / 3e-32 AT1G22450 138 / 9e-41 CYTOCHROME C OXIDASE 6B2, cytochrome C oxidase 6B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [poplar] [flax] CHCH PF02297 [poplar] [flax] COX6B Cytochrome oxidase c subunit VIb
Representative CDS sequence Show only first row Show all	>Potri.018G099900.1 pacid=42800426 polypeptide=Potri.018G099900.1.p locus=Potri.018G099900 ID=Potri.018G099900.1.v4.1 annot-version=v4.1 ATGGGAAAAGAGATTGAGCTGAAAACAGCTCCAGCTGATTATCGATTCCCTACGACAAATCAAACCAGACACTGTTTCACCCGCTACATTGAATTTCACA GGTGTGTGGCAGCGAAGGGTGATGAAGGAAATGATTGCGAGCGTTTTGCTAAATACTACCGTTCCCTTTGTCCCTCTGAGTGGGTCGAGAGGTGGAATGA GCAGAGGGAGAATGGAACATTTCCAGGTCCCCTTTGA
AA sequence Show only first row Show all	>Potri.018G099900.1 pacid=42800426 polypeptide=Potri.018G099900.1.p locus=Potri.018G099900 ID=Potri.018G099900.1.v4.1 annot-version=v4.1 MGKEIELKTAPADYRFPTTNQTRHCFTRYIEFHRCVAAKGDEGNDCERFAKYYRSLCPSEWVERWNEQRENGTFPGPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57815			Cytochrome c oxidase, subunit ...		Potri.018G099900 [exp]	0	1
AT3G48140			B12D protein (.1)		Potri.012G074900 [exp]	1.73	0.9063
AT4G29850			Eukaryotic protein of unknown ...		Potri.018G133500 [exp]	1.73	0.9300
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028200 [exp]	6.00	0.9047	Pt-ADF1.1
AT2G23090			Uncharacterised protein family...		Potri.014G018100 [exp]	6.00	0.8881
AT4G20410		GAMMA-SNAP, GSN...	gamma-soluble NSF attachment p...		Potri.011G155200 [exp]	6.92	0.8887	Pt-GSNAP.1
AT3G26670			Protein of unknown function (D...		Potri.014G139700 [exp]	7.00	0.8975
AT4G15830			ARM repeat superfamily protein...		Potri.008G221900 [exp]	7.07	0.9034
AT3G13410			unknown protein		Potri.001G000900 [exp]	7.61	0.9125
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.015G126301 [exp]	10.09	0.8884
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028100 [exp]	11.74	0.8979	ADF6,Pt-ADF.6

Compare expression of checked genes

Potri.018G099900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.