Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18430 264 / 2e-91 Calcium-binding EF-hand family protein (.1.2) AT3G51920 54 / 2e-09 CML9, CAM9, ATCML9 CALMODULIN LIKE PROTEIN 9, calmodulin 9 (.1) AT4G16350 47 / 1e-06 SCABP2, CBL6 SOS3-LIKE CALCIUM BINDING PROTEIN 2, calcineurin B-like protein 6 (.1) AT4G26570 47 / 2e-06 ATCBL3 calcineurin B-like 3 (.1.2) AT3G50360 46 / 2e-06 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) AT5G55990 45 / 6e-06 ATCBL2, CBL2 calcineurin B-like protein 2 (.1) AT1G24620 42 / 4e-05 EF hand calcium-binding protein family (.1) AT4G26560 42 / 8e-05 CBL7 calcineurin B-like protein 7 (.1) AT5G24270 41 / 0.0002 ATSOS3, CBL4, SOS3 CALCINEURIN B-LIKE PROTEIN 4, SALT OVERLY SENSITIVE 3, Calcium-binding EF-hand family protein (.1.2) AT2G41090 39 / 0.001 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G030300 [exp] 269 / 2e-93 AT3G18430 295 / 6e-104 Calcium-binding EF-hand family protein (.1.2) Potri.005G138000 [exp] 51 / 3e-08 AT3G50360 275 / 4e-96 CENTRIN 1, centrin2 (.1) Potri.003G037800 [exp] 50 / 1e-07 AT4G33000 286 / 5e-98 SOS3-LIKE CALCIUM BINDING PROTEIN 8, calcineurin B-like protein 10 (.1.2.3) Potri.011G094900 [exp] 48 / 5e-07 AT4G26570 408 / 6e-147 calcineurin B-like 3 (.1.2) Potri.016G003500 [exp] 47 / 9e-07 AT5G55990 420 / 2e-151 calcineurin B-like protein 2 (.1) Potri.005G215700 [exp] 44 / 5e-06 AT3G22930 200 / 8e-67 calmodulin-like 11 (.1) Potri.006G002900 [exp] 45 / 6e-06 AT5G55990 414 / 5e-149 calcineurin B-like protein 2 (.1) Potri.001G371700 [exp] 45 / 8e-06 AT5G55990 418 / 9e-151 calcineurin B-like protein 2 (.1) Potri.015G013200 [exp] 40 / 0.0002 AT5G24270 291 / 8e-101 CALCINEURIN B-LIKE PROTEIN 4, SALT OVERLY SENSITIVE 3, Calcium-binding EF-hand family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010775 [exp] 300 / 1e-105 AT3G18430 273 / 6e-95 Calcium-binding EF-hand family protein (.1.2) Lus10022173 [exp] 271 / 2e-94 AT3G18430 257 / 6e-89 Calcium-binding EF-hand family protein (.1.2) Lus10029670 [exp] 258 / 4e-89 AT3G18430 277 / 1e-96 Calcium-binding EF-hand family protein (.1.2) Lus10042708 [exp] 251 / 2e-86 AT3G18430 271 / 4e-94 Calcium-binding EF-hand family protein (.1.2) Lus10001816 [exp] 48 / 5e-07 AT1G64480 271 / 3e-93 calcineurin B-like protein 8 (.1) Lus10038764 [exp] 47 / 1e-06 AT5G55990 375 / 5e-134 calcineurin B-like protein 2 (.1) Lus10003191 [exp] 47 / 1e-06 AT1G64480 264 / 2e-90 calcineurin B-like protein 8 (.1) Lus10039098 [exp] 47 / 3e-06 AT5G55990 374 / 1e-128 calcineurin B-like protein 2 (.1) Lus10011028 [exp] 43 / 3e-05 AT4G17615 359 / 5e-128 SOS3-LIKE CALCIUM BINDING PROTEIN 5, ARABIDOPSIS THALIANA CALCINEURIN B-LIKE PROTEIN, calcineurin B-like protein 1 (.1.2) Lus10022407 [exp] 43 / 3e-05 AT5G24270 331 / 1e-116 CALCINEURIN B-LIKE PROTEIN 4, SALT OVERLY SENSITIVE 3, Calcium-binding EF-hand family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.018G103600.1 pacid=42801160 polypeptide=Potri.018G103600.1.p locus=Potri.018G103600 ID=Potri.018G103600.1.v4.1 annot-version=v4.1 ATGGGCAACACATCTTCGATGCTCACTCAATACGACATCGAAGAAGTCCAACAACACTGTAACCACACCTTCTCGCAGCAAGAGACAGTGTCGTTGTACC AGAGGTTTTGCCAGCTGGATCGAAACGGCTGCGGTTTCGTCCCAGCCGAGGAGTTCCTTTCCGTTCCTGAATTCGCCGTCAATCCTCTCTCTCAGAGATT GTTGAGAATGGTAGATGGACTGAATTTCAAGGAATTTGTGGCATTCTTGTCTGCATTCAGTCCTCGAGCTCCTTTGCAACACAAAATCGAATTTATCTTC AAGGTGTATGATTCGGATGGCAATGGGAAAGTTACCTTCAGTGATATGTTGGATGTATTGCATGATTTGACCGGTCAGTTTGTATCAGAACAACAAAGAA AGCAAGTGCTGACATGTGTCCTTGAAGAAGCAGGTTACTCAAAGGATTCTTTCTTAGTCTTGTCAGACTTTGTAAAGATTCTTGGAAATTCTGATTTGAA GATGGAAGTTGAAGTTCCAGTGGACTAA
AA sequence Show only first row Show all	>Potri.018G103600.1 pacid=42801160 polypeptide=Potri.018G103600.1.p locus=Potri.018G103600 ID=Potri.018G103600.1.v4.1 annot-version=v4.1 MGNTSSMLTQYDIEEVQQHCNHTFSQQETVSLYQRFCQLDRNGCGFVPAEEFLSVPEFAVNPLSQRLLRMVDGLNFKEFVAFLSAFSPRAPLQHKIEFIF KVYDSDGNGKVTFSDMLDVLHDLTGQFVSEQQRKQVLTCVLEEAGYSKDSFLVLSDFVKILGNSDLKMEVEVPVD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18430			Calcium-binding EF-hand family...		Potri.018G103600 [exp]	0	1
AT4G14340		CKL11, CKI1	CASEIN KINASE I-LIKE 11, casei...		Potri.013G047200 [exp]	4.24	0.7436	Pt-CKI1.1
AT5G14670		ATARFA1B	ADP-ribosylation factor A1B (....		Potri.013G005500 [exp]	5.47	0.7709
AT1G23750			Nucleic acid-binding, OB-fold-...		Potri.008G189900 [exp]	7.07	0.7703
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Potri.013G010000 [exp]	7.41	0.7656
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.005G126500 [exp]	8.36	0.7596
AT5G19630			alpha/beta-Hydrolases superfam...		Potri.001G013700 [exp]	8.71	0.6914
AT4G08230			glycine-rich protein (.1.2)		Potri.005G174700 [exp]	13.07	0.7675
AT5G27200		ACP5	acyl carrier protein 5 (.1)		Potri.005G044800 [exp]	15.74	0.7664	Pt-ACP1.1
AT5G16450			Ribonuclease E inhibitor RraA/...		Potri.019G053800 [exp]	15.87	0.7261
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Potri.017G081400 [exp]	16.91	0.7395

Compare expression of checked genes

Potri.018G103600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.