Plant FIBer expression Database

Potri.018G105200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G007600
[exp]
48 / 5e-09 AT5G53560 153 / 8e-49 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
Potri.012G024600
[exp]
44 / 2e-07 AT5G53560 163 / 5e-53 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.018G105200.2 pacid=42802011 polypeptide=Potri.018G105200.2.p locus=Potri.018G105200 ID=Potri.018G105200.2.v4.1 annot-version=v4.1
ATGGCTCCTCCGAAGGTTTACTTATTTGATGAGATTGCCAAGCACAAGAAAACCGAGGATTGCTGTCCGAATATCTCTGGAAAGGAAACTTGCTCTCCAT
CCAGTAAGTGCGCAGGCAAGGGAAAACAAAAACAACTTGCAGAGGATTGA
AA sequence
>Potri.018G105200.2 pacid=42802011 polypeptide=Potri.018G105200.2.p locus=Potri.018G105200 ID=Potri.018G105200.2.v4.1 annot-version=v4.1
MAPPKVYLFDEIAKHKKTEDCCPNISGKETCSPSSKCAGKGKQKQLAED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G105200
[exp]
0 1
AT3G47300 SELT SELT-like protein precursor (.... Potri.009G047000
[exp]
3.46 0.8214
AT3G50910 unknown protein Potri.007G022100
[exp]
5.00 0.8343
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.004G121800
[exp]
5.29 0.8279
AT3G47500 DOF CDF3, AtDof3,3 cycling DOF factor 3 (.1) Potri.010G167600
[exp]
10.95 0.8273
AT3G17460 PHD finger family protein (.1) Potri.008G206600
[exp]
15.00 0.7994
AT3G06190 ATBPM2 BTB-POZ and MATH domain 2 (.1.... Potri.010G029500
[exp]
21.67 0.7397
AT5G40250 RING/U-box superfamily protein... Potri.015G073600
[exp]
22.36 0.8131
AT2G42280 bHLH bHLH130 basic helix-loop-helix (bHLH) ... Potri.003G207200
[exp]
24.53 0.7429
AT3G02380 CO ATCOL2, COL2 CONSTANS-like 2 (.1) Potri.004G108320
[exp]
27.34 0.8128
AT4G38100 unknown protein Potri.005G147801
[exp]
34.07 0.8147

Potri.018G105200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.