Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63260 57 / 3e-10 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) AT3G48440 48 / 3e-07 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) AT3G06410 42 / 3e-05 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) AT5G18550 41 / 7e-05 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) AT5G16540 38 / 0.0008 C3HZnF ZFN3 zinc finger nuclease 3 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G089100 [exp] 96 / 4e-24 AT5G63260 373 / 9e-126 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Potri.012G092500 [exp] 91 / 3e-22 AT5G63260 362 / 2e-121 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Potri.008G215700 [exp] 39 / 0.0003 AT5G18550 397 / 8e-135 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) Potri.010G176300 [exp] 39 / 0.0003 AT3G12680 578 / 0.0 ENHANCER OF AG-4 1, floral homeotic protein (HUA1) (.1) Potri.008G080300 [exp] 39 / 0.0004 AT3G12680 544 / 0.0 ENHANCER OF AG-4 1, floral homeotic protein (HUA1) (.1) Potri.014G159500 [exp] 39 / 0.0005 AT1G04990 312 / 6e-103 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Potri.010G022500 [exp] 38 / 0.0009 AT5G18550 422 / 7e-145 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) Potri.013G086800 [exp] 38 / 0.001 AT3G02830 542 / 0.0 zinc finger protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043330 [exp] 57 / 2e-10 AT5G63260 357 / 3e-119 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10019481 [exp] 56 / 9e-10 AT5G63260 339 / 6e-112 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10007941 [exp] 40 / 0.0002 AT2G47850 524 / 0.0 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2.3) Lus10013476 [exp] 40 / 0.0002 AT2G47850 532 / 0.0 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G108850.1 pacid=42802232 polypeptide=Potri.018G108850.1.p locus=Potri.018G108850 ID=Potri.018G108850.1.v4.1 annot-version=v4.1 ATGATCAAAAGAGTGAGAATTTTCATGAGAACGATAAGTGAGAAGGTCGGTGATGGTTTAGATAAGAAGAATGAGAGAAGTAATGGCAATGTGAATAATG ATAAAAGGTTGTCTCATCAGTATCATGTGAGACCTGAAGCAAAGGATCGTGCTTCTTATATGAATATTGGGACCTACAAATTTGGAGCTAATTGCAAGTT TAATCATCCTATAAGAAGGAAAAATCAGGCACAACTTCTTCTTCTTCCTCCTCCTCCTCCTCTTCTTCTTCTTGAGTTATTATTTGGGTTTGTGTTTTCA CGTGTGTATATTTTGTTGGTTTACTGTTGTTGGTGTAAATCTAGTGTTTTTAGACAAGGACAGCATAAATAA
AA sequence Show only first row Show all	>Potri.018G108850.1 pacid=42802232 polypeptide=Potri.018G108850.1.p locus=Potri.018G108850 ID=Potri.018G108850.1.v4.1 annot-version=v4.1 MIKRVRIFMRTISEKVGDGLDKKNERSNGNVNNDKRLSHQYHVRPEAKDRASYMNIGTYKFGANCKFNHPIRRKNQAQLLLLPPPPPLLLLELLFGFVFS RVYILLVYCCWCKSSVFRQGQHK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G63260	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.018G108850 [exp]	0	1
AT1G77140		ATVPS45, VPS45	vacuolar protein sorting 45 (....		Potri.005G188000 [exp]	7.48	0.7583	VPS45.1
					Potri.005G203550 [exp]	8.60	0.7747
AT5G15880			unknown protein		Potri.017G110300 [exp]	24.97	0.7264
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.001G335100 [exp]	31.52	0.6028
AT1G71340		AtGDPD4	glycerophosphodiester phosphod...		Potri.013G095300 [exp]	32.31	0.7139
AT4G14965		ATMAPR4	membrane-associated progestero...		Potri.016G022700 [exp]	34.62	0.6171
AT3G03220		ATHEXPALPHA1.22...	EXPANSIN 13, expansin A13 (.1)		Potri.017G140000 [exp]	38.06	0.6927	EXP2.10
AT3G29170			Eukaryotic protein of unknown ...		Potri.016G054301 [exp]	38.52	0.7253
AT2G44500			O-fucosyltransferase family pr...		Potri.001G227000 [exp]	44.49	0.7025
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Potri.002G010300 [exp]	52.45	0.6278

Compare expression of checked genes

Potri.018G108850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.