Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58005 174 / 1e-57 Cytochrome c oxidase, subunit Vib family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G186500 [exp] 227 / 9e-79 AT5G58005 173 / 1e-57 Cytochrome c oxidase, subunit Vib family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021847 [exp] 150 / 1e-48 AT5G58005 150 / 3e-48 Cytochrome c oxidase, subunit Vib family protein (.1.2) Lus10036285 [exp] 147 / 3e-47 AT5G58005 146 / 7e-47 Cytochrome c oxidase, subunit Vib family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [poplar] [flax] CHCH PF02297 [poplar] [flax] COX6B Cytochrome oxidase c subunit VIb
Representative CDS sequence Show only first row Show all	>Potri.018G109400.4 pacid=42801221 polypeptide=Potri.018G109400.4.p locus=Potri.018G109400 ID=Potri.018G109400.4.v4.1 annot-version=v4.1 ATGGCTATGGAAAACTATGCATCAAGAAATATTGACAAAATTCACACAGATGTCCTCTCTCAATCAAGACAAGCTTGCTACAAGGCGCGAGATGCTTTTT TTGCTTGTTTGGAGAAAGAATCAGGCAAGAAACCTACAGAAATTGGGTCCGTGGGGCTTCAATATCCAGCTGAATGTAAAAACTCAAGGGCTGAGTTTGA GAAGAATTGTAGACCTGCTTGGGTGAAGCATTTTGATAGGCTACACTGTAGGAACAAGACATCGCAGAGGTTGTTGGAAGACAAGGAAACCAGGAGAGGT CCGTTGTTGCTTCCTCAGCCTTACACTTTCAAGCCTACTTCTAGTACTTAA
AA sequence Show only first row Show all	>Potri.018G109400.4 pacid=42801221 polypeptide=Potri.018G109400.4.p locus=Potri.018G109400 ID=Potri.018G109400.4.v4.1 annot-version=v4.1 MAMENYASRNIDKIHTDVLSQSRQACYKARDAFFACLEKESGKKPTEIGSVGLQYPAECKNSRAEFEKNCRPAWVKHFDRLHCRNKTSQRLLEDKETRRG PLLLPQPYTFKPTSST

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G58005			Cytochrome c oxidase, subunit ...		Potri.018G109400 [exp]	0	1
AT5G61540			N-terminal nucleophile aminohy...		Potri.014G191900 [exp]	3.87	0.8983
AT2G23090			Uncharacterised protein family...		Potri.014G018100 [exp]	4.89	0.8728
AT1G28120			unknown protein		Potri.001G067400 [exp]	4.89	0.8738
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Potri.009G001100 [exp]	6.92	0.8592
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Potri.001G211600 [exp]	8.48	0.8667
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Potri.011G139300 [exp]	12.40	0.8718	ATMAK3.5
AT4G16710			glycosyltransferase family pro...		Potri.013G025600 [exp]	14.14	0.8709
					Potri.001G466500 [exp]	15.93	0.8833
AT3G15290			3-hydroxyacyl-CoA dehydrogenas...		Potri.001G398600 [exp]	16.85	0.8149
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.004G156900 [exp]	17.40	0.8794	Pt-RER1.2

Compare expression of checked genes

Potri.018G109400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.