Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58060 375 / 8e-135 ATYKT61, ATGP1, YKT61 SNARE-like superfamily protein (.1.2) AT5G58180 320 / 4e-113 ATYKT62 Synaptobrevin family protein (.1.2) AT5G11150 63 / 4e-12 ATVAMP713 vesicle-associated membrane protein 713 (.1) AT4G32150 61 / 2e-11 ATVAMP711, VAMP7C vesicle-associated membrane protein 711 (.1) AT1G11890 57 / 3e-10 ATSEC22, SEC22 SECRETION 22, Synaptobrevin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G187700 [exp] 397 / 2e-143 AT5G58060 381 / 5e-137 SNARE-like superfamily protein (.1.2) Potri.006G256200 [exp] 63 / 5e-12 AT4G32150 352 / 5e-125 vesicle-associated membrane protein 711 (.1) Potri.018G025800 [exp] 62 / 8e-12 AT4G32150 366 / 2e-130 vesicle-associated membrane protein 711 (.1) Potri.018G125900 [exp] 61 / 4e-11 AT4G32150 276 / 1e-94 vesicle-associated membrane protein 711 (.1) Potri.001G165600 [exp] 55 / 3e-09 AT1G11890 427 / 9e-155 SECRETION 22, Synaptobrevin family protein (.1) Potri.003G069900 [exp] 54 / 5e-09 AT1G11890 429 / 2e-155 SECRETION 22, Synaptobrevin family protein (.1) Potri.001G050400 [exp] 47 / 2e-06 AT2G33120 365 / 4e-130 ARABIDOPSIS THALIANA VESICLE-ASSOCIATED MEMBRANE PROTEIN 722, synaptobrevin-related protein 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036297 [exp] 369 / 4e-132 AT5G58060 364 / 3e-130 SNARE-like superfamily protein (.1.2) Lus10019047 [exp] 367 / 3e-131 AT5G58060 362 / 3e-129 SNARE-like superfamily protein (.1.2) Lus10008135 [exp] 57 / 9e-10 AT1G11890 363 / 7e-129 SECRETION 22, Synaptobrevin family protein (.1) Lus10036987 [exp] 56 / 2e-09 AT1G11890 415 / 6e-150 SECRETION 22, Synaptobrevin family protein (.1) Lus10001492 [exp] 53 / 2e-08 AT5G11150 367 / 1e-130 vesicle-associated membrane protein 713 (.1) Lus10013175 [exp] 52 / 3e-08 AT1G11890 411 / 2e-148 SECRETION 22, Synaptobrevin family protein (.1) Lus10000504 [exp] 49 / 7e-07 AT4G15780 293 / 3e-100 vesicle-associated membrane protein 724 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF13774 [poplar] [flax] Longin Regulated-SNARE-like domain
Representative CDS sequence Show only first row Show all	>Potri.018G110700.1 pacid=42801652 polypeptide=Potri.018G110700.1.p locus=Potri.018G110700 ID=Potri.018G110700.1.v4.1 annot-version=v4.1 ATGAAGATCACGGCGTTATTGGTATTGAAGGTCAACCCGGAAGGATCGGATCCGGTTATTTTAGCTAACGCTTGCGATGTGAGTCATTTCGGGTATTTCC AGCGGTCTAGTGTTAGGGAATTCATCGTTTTCGTCGGTCGAACCGTCGCTAAACGCACCCCACCGGGCCAACGCCAATCCGTCCAGCACGAAGAGTACAA AGTGCATGCTTATAACCGAAATGGACTTTGTGCGTTGGGGTTTATGGACGATCATTATCCGGTTCGCAGCTCATTTTCCCTTCTCGATAAGGTGATTGAA GAGTATCAAAAGAATTTCGGTGAATCTTGGAGGACTGCACAAGCAGATAGTAGTCAACCTTGGCCATATTTGAATGAAGCTTTGACCAAGTTCCAAGATC CTGCAGAGGCAGACAAATTGTTGAAAATCCAGAGGGAGTTGGACGAGACAAAAATTATCCTTCATAAGACCATTGACAGTGTGCTTGCACGAGGTGAGAA ACTTGACAGTTTAGTCGAGAAGAGTTCTGATCTGAGTGCTGCATCACAGATGTTCTACAAGCAGGCGAAGAAAACCAATCAATGTTGTACCATACTGTAG
AA sequence Show only first row Show all	>Potri.018G110700.1 pacid=42801652 polypeptide=Potri.018G110700.1.p locus=Potri.018G110700 ID=Potri.018G110700.1.v4.1 annot-version=v4.1 MKITALLVLKVNPEGSDPVILANACDVSHFGYFQRSSVREFIVFVGRTVAKRTPPGQRQSVQHEEYKVHAYNRNGLCALGFMDDHYPVRSSFSLLDKVIE EYQKNFGESWRTAQADSSQPWPYLNEALTKFQDPAEADKLLKIQRELDETKIILHKTIDSVLARGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCTIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.018G110700 [exp]	0	1
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Potri.014G086600 [exp]	1.00	0.8981	Pt-UBC4.2
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Potri.012G033000 [exp]	2.00	0.8540	UBC9.1
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Potri.005G109900 [exp]	2.82	0.8101
AT5G57860			Ubiquitin-like superfamily pro...		Potri.006G181400 [exp]	3.16	0.8060
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.002G138400 [exp]	4.58	0.7936	RAB1.3
AT1G13950		EIF5A, ATELF5A-...	eukaryotic elongation factor 5...		Potri.006G185000 [exp]	6.70	0.7751	Pt-EIF.4
AT1G17280		UBC34	ubiquitin-conjugating enzyme 3...		Potri.001G162200 [exp]	7.87	0.7118
AT2G01600			ENTH/ANTH/VHS superfamily prot...		Potri.010G110000 [exp]	7.87	0.7445
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.003G045300 [exp]	8.71	0.7368
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.009G118500 [exp]	11.22	0.7647

Compare expression of checked genes

Potri.018G110700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.