Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23290 257 / 4e-82 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) AT4G23180 256 / 5e-81 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23240 246 / 1e-80 CRK16 cysteine-rich RLK (RECEPTOR-like protein kinase) 16 (.1) AT4G23260 253 / 3e-80 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2) AT1G11330 254 / 3e-79 S-locus lectin protein kinase family protein (.1.2) AT4G23150 251 / 3e-79 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G23310 253 / 7e-79 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) AT3G45860 249 / 2e-78 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT1G65790 252 / 3e-78 ARK1 receptor kinase 1 (.1) AT4G23230 244 / 4e-78 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111600 [exp] 489 / 1e-170 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.018G111800 [exp] 360 / 1e-120 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111700 [exp] 360 / 2e-120 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111900 [exp] 325 / 9e-107 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.011G036466 [exp] 256 / 2e-84 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1) Potri.004G023550 [exp] 264 / 5e-84 AT4G05200 541 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.005G014802 [exp] 258 / 8e-84 AT1G11330 454 / 5e-152 S-locus lectin protein kinase family protein (.1.2) Potri.004G027400 [exp] 265 / 3e-83 AT1G11330 872 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.004G024632 [exp] 253 / 3e-83 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040020 [exp] 307 / 3e-106 AT4G23180 246 / 4e-77 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10019061 [exp] 301 / 2e-97 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10024081 [exp] 291 / 1e-93 AT1G61500 333 / 5e-102 S-locus lectin protein kinase family protein (.1) Lus10041639 [exp] 289 / 1e-92 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1) Lus10036314 [exp] 266 / 2e-88 AT4G23180 315 / 6e-102 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10036313 [exp] 265 / 3e-87 AT4G03230 241 / 9e-71 S-locus lectin protein kinase family protein (.1) Lus10033752 [exp] 249 / 8e-82 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10023391 [exp] 260 / 1e-79 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10019060 [exp] 244 / 4e-77 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10020083 [exp] 237 / 2e-76 AT4G21390 427 / 6e-143 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.018G111751.1 pacid=42801044 polypeptide=Potri.018G111751.1.p locus=Potri.018G111751 ID=Potri.018G111751.1.v4.1 annot-version=v4.1 ATGAGTACATGCCAAAAAAAAAACCTGGACTCTTACCTATTTGATCCGATTAGGCGATATTTGTTGGATTGGAAGAAAAGGGAAGAAATCATTGAAGGGA TTACTCAAGGCCTTCTATACCTCCAAGAATATTCGAGACTGACAATTATCCACCGAGACTTGAAAGCCAGCAACATTTTACTGGATGGGGATATGAAGCC TAAGATATCTGATTTTGGTATGGCTAGAATTTTCACAAAAGATGAACAAGAAGCAAACACTAGCCGGCTTGTTGGGACATACGGTTATGTTCCTCCGGAA TACGTCAGAAACGGCGTGTATTCCATAAAATCTGATGTTTACAGTTTTGGAATAGTACTACTGCACATCATAAGCGGCAAGAAGAATGGCTCTTTGTATG GTTCTGATGAAACTTTAAGCCTCCTAGAATATGCTTACGAGCTATGGAAAGATGGTAAAGGCATGGAGATCATGGATCCATCGCTGGATGATACATTGTC CTCTTGTAAATTGATCAAATGCTTGCAAATTGCACTGCTATGTGTCCAAGAAAATCCTATTGATAGGCCGTCTATGCTGGAAGTTTCTTCAATGCTCAAA AACGAAACTGCCATTGTGACCATTCCCAAAAGGCCTGCTTTTTCTGTGAAGACAGATGAAGATGACAAAAACAGACGTGATCAATTGCACATAAAGATTT GTTCAGTTGATGATGCAACAATTTCGCAAGTCGTCGGGCGATGA
AA sequence Show only first row Show all	>Potri.018G111751.1 pacid=42801044 polypeptide=Potri.018G111751.1.p locus=Potri.018G111751 ID=Potri.018G111751.1.v4.1 annot-version=v4.1 MSTCQKKNLDSYLFDPIRRYLLDWKKREEIIEGITQGLLYLQEYSRLTIIHRDLKASNILLDGDMKPKISDFGMARIFTKDEQEANTSRLVGTYGYVPPE YVRNGVYSIKSDVYSFGIVLLHIISGKKNGSLYGSDETLSLLEYAYELWKDGKGMEIMDPSLDDTLSSCKLIKCLQIALLCVQENPIDRPSMLEVSSMLK NETAIVTIPKRPAFSVKTDEDDKNRRDQLHIKICSVDDATISQVVGR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23290		CRK21	cysteine-rich RLK (RECEPTOR-li...		Potri.018G111751 [exp]	0	1
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.018G111600 [exp]	2.44	0.9642
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221300 [exp]	3.16	0.9361
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125151 [exp]	6.92	0.9426
AT5G08280		HEMC	hydroxymethylbilane synthase (...		Potri.005G091600 [exp]	7.00	0.9253
					Potri.004G050700 [exp]	8.12	0.9261
AT1G11340			S-locus lectin protein kinase ...		Potri.004G028701 [exp]	8.71	0.9034
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Potri.018G033400 [exp]	9.64	0.8553	2OGox9
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Potri.001G255800 [exp]	10.58	0.9395
AT3G21090		ABCG15	ATP-binding cassette G15, ABC-...		Potri.009G051200 [exp]	11.66	0.9188
AT3G06868			unknown protein		Potri.008G220700 [exp]	11.74	0.8978

Compare expression of checked genes

Potri.018G111751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.