Potri.018G112301 [POPLAR]

| External link |
|
|||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Symbol | ||||||||||||||||||||||||||
|
Arabidopsis homologues
|
| |||||||||||||||||||||||||
|
Paralogs
|
|
|||||||||||||||||||||||||
|
Flax homologues |
|
|||||||||||||||||||||||||
| PFAM info |
| |||||||||||||||||||||||||
|
Representative CDS sequence |
>Potri.018G112301.1 pacid=42801315 polypeptide=Potri.018G112301.1.p locus=Potri.018G112301 ID=Potri.018G112301.1.v4.1 annot-version=v4.1
ATGCCGTCACACAAGACCTTCAGGATCAAGAAGAAGCTGGCGAAGAAGATGAGGCAGAACAGGCCCATCCCTCACTGGATCCGCATGAGAACTGACAATA
CCATCAGGTACAATGCGAAGCGCAGGCACTGGCGCCGTACCAAGCTAGGGTTTTGA
|
|||||||||||||||||||||||||
|
AA sequence
|
>Potri.018G112301.1 pacid=42801315 polypeptide=Potri.018G112301.1.p locus=Potri.018G112301 ID=Potri.018G112301.1.v4.1 annot-version=v4.1
MPSHKTFRIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAKRRHWRRTKLGF
|
DESeq2's median of ratios [POPLAR]
Coexpressed genes
Potri.018G112301 coexpression network
*The number of genes in the network is adjusted within 50 genes.*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.