Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15580 161 / 2e-50 RING/U-box superfamily protein (.1.2) AT1G49850 67 / 1e-13 RING/U-box superfamily protein (.1) AT4G26400 64 / 3e-12 RING/U-box superfamily protein (.1.2) AT3G58720 63 / 5e-12 RING/U-box superfamily protein (.1.2) AT5G56340 64 / 7e-12 ATCRT1 RING/U-box superfamily protein (.1) AT3G19950 61 / 5e-11 RING/U-box superfamily protein (.1) AT1G26800 59 / 6e-11 RING/U-box superfamily protein (.1) AT1G55530 59 / 2e-10 RING/U-box superfamily protein (.1) AT1G18760 58 / 3e-10 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT3G13228 58 / 3e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G190300 [exp] 328 / 5e-116 AT2G15580 170 / 2e-53 RING/U-box superfamily protein (.1.2) Potri.009G091200 [exp] 66 / 4e-13 AT1G49850 108 / 3e-28 RING/U-box superfamily protein (.1) Potri.001G297000 [exp] 62 / 1e-11 AT1G49850 107 / 2e-27 RING/U-box superfamily protein (.1) Potri.015G028400 [exp] 60 / 8e-11 AT3G19950 256 / 2e-83 RING/U-box superfamily protein (.1) Potri.014G139400 [exp] 59 / 1e-10 AT3G58720 163 / 3e-49 RING/U-box superfamily protein (.1.2) Potri.009G034700 [exp] 59 / 2e-10 AT3G55530 333 / 1e-115 SALT- AND DROUGHT-INDUCED RING FINGER1, RING/U-box superfamily protein (.1) Potri.012G036700 [exp] 59 / 2e-10 AT3G19950 273 / 5e-90 RING/U-box superfamily protein (.1) Potri.012G136400 [exp] 57 / 3e-10 AT5G52140 113 / 1e-30 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 58 / 5e-10 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030120 [exp] 177 / 2e-56 AT2G15580 139 / 2e-41 RING/U-box superfamily protein (.1.2) Lus10001685 [exp] 157 / 2e-48 AT2G15580 131 / 2e-38 RING/U-box superfamily protein (.1.2) Lus10001688 [exp] 84 / 6e-21 AT2G15580 76 / 2e-18 RING/U-box superfamily protein (.1.2) Lus10002113 [exp] 66 / 7e-13 AT1G49850 133 / 2e-37 RING/U-box superfamily protein (.1) Lus10017383 [exp] 57 / 7e-11 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1) Lus10012819 [exp] 59 / 2e-10 AT1G26800 182 / 6e-58 RING/U-box superfamily protein (.1) Lus10010179 [exp] 59 / 2e-10 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1) Lus10013397 [exp] 59 / 3e-10 AT5G56340 330 / 5e-111 RING/U-box superfamily protein (.1) Lus10030755 [exp] 58 / 4e-10 AT2G40830 336 / 2e-115 RING-H2 finger C1A (.1.2.3) Lus10013235 [exp] 58 / 4e-10 AT2G40830 334 / 7e-115 RING-H2 finger C1A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.018G114500.5 pacid=42801134 polypeptide=Potri.018G114500.5.p locus=Potri.018G114500 ID=Potri.018G114500.5.v4.1 annot-version=v4.1 ATGGCTGGTATGTTGCCTGGTGTTGAATGTGCTCGAAGGAGGAGGTTCCATCAAAGCGGAGATTCACTTGGTGCCCCAGCACACGGCTGGTCCAGAAAGC CATCTTTTTGTTTGTACACAAGCAGCCATGAAAGTTATCATGGCTCCGTCTCTTCTCTGCAAAAGCAAAAGCAAAGGAGCGTATCAAGCCAGGCATACGA GGATGAGAAGCTGGGAGGAGTGGCAAGAGAAGCCAAGGAAAGATTAGATGAGAGGCTAAGATTGCAAAAGAAGAAGACAGCAGAAACCACAAGGCACAAA AGCACAGGAAACCTGAGAGATGTAGATGGCAGATCAATGGTACTAGGGGAGTTACAGATGGAGGTGTATGGTACGAAGAGGAGTGGGTCTAAGAGGTTCA ATTGGGCCAAACTGAGCTGGAAAGCTGCTGACCAAGACGAGTGCACCATCTGCCTCGATCGGTTCAAGTCTGGTGAGACCCTGGTGCACCTTCCCTGTGC ACACAGGTACCACCCCAGGTGTTTGGTGCCATGGCTAGAAAACAATGGCCATTGTCCTTGTTGCAGGATGGAAATACGTGTTGAACTCTCCTAG
AA sequence Show only first row Show all	>Potri.018G114500.5 pacid=42801134 polypeptide=Potri.018G114500.5.p locus=Potri.018G114500 ID=Potri.018G114500.5.v4.1 annot-version=v4.1 MAGMLPGVECARRRRFHQSGDSLGAPAHGWSRKPSFCLYTSSHESYHGSVSSLQKQKQRSVSSQAYEDEKLGGVAREAKERLDERLRLQKKKTAETTRHK STGNLRDVDGRSMVLGELQMEVYGTKRSGSKRFNWAKLSWKAADQDECTICLDRFKSGETLVHLPCAHRYHPRCLVPWLENNGHCPCCRMEIRVELS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G15580			RING/U-box superfamily protein...		Potri.018G114500 [exp]	0	1
AT2G31190		WXR1, RUS2	weak auxin response1, ROOT UV-...		Potri.005G224000 [exp]	4.00	0.9253
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Potri.019G054300 [exp]	5.47	0.9123
AT5G25220	HD	KNAT3	KNOTTED1-like homeobox gene 3 ...		Potri.006G190000 [exp]	7.14	0.9238
AT3G04940		ATCYSD1	cysteine synthase D1 (.1)		Potri.005G048132 [exp]	7.74	0.8944
					Potri.003G054001 [exp]	8.00	0.9042
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Potri.005G179600 [exp]	9.64	0.8815
AT3G26590			MATE efflux family protein (.1...		Potri.019G063500 [exp]	10.39	0.9035
AT1G10690			unknown protein		Potri.010G045200 [exp]	10.77	0.8832
					Potri.012G082300 [exp]	11.61	0.8847
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Potri.012G065100 [exp]	11.95	0.9012

Compare expression of checked genes

Potri.018G114500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.