Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G12646 318 / 2e-110 PLATZ transcription factor family protein (.1) AT3G60670 183 / 1e-57 PLATZ transcription factor family protein (.1) AT1G31040 153 / 1e-45 PLATZ transcription factor family protein (.1) AT1G76590 109 / 6e-29 PLATZ transcription factor family protein (.1) AT1G32700 107 / 2e-28 PLATZ transcription factor family protein (.1.2) AT4G17900 105 / 1e-27 PLATZ transcription factor family protein (.1.2) AT1G21000 105 / 2e-27 PLATZ transcription factor family protein (.1.2) AT1G43000 103 / 9e-27 PLATZ transcription factor family protein (.1) AT2G27930 94 / 1e-23 PLATZ transcription factor family protein (.1) AT5G46710 94 / 3e-23 PLATZ transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G060500 [exp] 407 / 5e-146 AT2G12646 321 / 1e-111 PLATZ transcription factor family protein (.1) Potri.001G159200 [exp] 168 / 1e-51 AT1G31040 294 / 3e-101 PLATZ transcription factor family protein (.1) Potri.003G075600 [exp] 164 / 1e-49 AT1G31040 306 / 1e-105 PLATZ transcription factor family protein (.1) Potri.014G059300 [exp] 162 / 2e-49 AT3G60670 238 / 6e-79 PLATZ transcription factor family protein (.1) Potri.002G144900 [exp] 155 / 1e-46 AT3G60670 250 / 7e-84 PLATZ transcription factor family protein (.1) Potri.006G119400 [exp] 114 / 3e-31 AT2G27930 212 / 3e-70 PLATZ transcription factor family protein (.1) Potri.016G097100 [exp] 112 / 2e-30 AT1G32700 200 / 3e-65 PLATZ transcription factor family protein (.1.2) Potri.019G051200 [exp] 111 / 8e-30 AT4G17900 309 / 2e-107 PLATZ transcription factor family protein (.1.2) Potri.013G078500 [exp] 111 / 1e-29 AT4G17900 312 / 1e-108 PLATZ transcription factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008814 [exp] 301 / 2e-103 AT2G12646 301 / 4e-103 PLATZ transcription factor family protein (.1) Lus10039989 [exp] 291 / 5e-99 AT2G12646 292 / 3e-99 PLATZ transcription factor family protein (.1) Lus10008031 [exp] 288 / 2e-98 AT2G12646 294 / 1e-100 PLATZ transcription factor family protein (.1) Lus10038103 [exp] 274 / 5e-93 AT2G12646 289 / 1e-98 PLATZ transcription factor family protein (.1) Lus10009283 [exp] 174 / 5e-54 AT3G60670 249 / 2e-83 PLATZ transcription factor family protein (.1) Lus10015881 [exp] 173 / 2e-53 AT3G60670 251 / 4e-84 PLATZ transcription factor family protein (.1) Lus10036226 [exp] 122 / 2e-34 AT1G31040 191 / 3e-61 PLATZ transcription factor family protein (.1) Lus10020337 [exp] 117 / 2e-31 AT4G17900 282 / 3e-96 PLATZ transcription factor family protein (.1.2) Lus10038365 [exp] 115 / 3e-31 AT1G31040 142 / 9e-42 PLATZ transcription factor family protein (.1) Lus10000482 [exp] 114 / 1e-30 AT4G17900 284 / 2e-97 PLATZ transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04640 [poplar] [flax] PLATZ PLATZ transcription factor
Representative CDS sequence Show only first row Show all	>Potri.018G116000.1 pacid=42800550 polypeptide=Potri.018G116000.1.p locus=Potri.018G116000 ID=Potri.018G116000.1.v4.1 annot-version=v4.1 ATGGGAATTCAAAAGCCTGCATGGTTGGGAGCTCTTTACACACAAAAGTTTTTTGCAGGGTGCTCTTATCATGAAGCTGCAAAGAAGAATGAAAAGAACG TGTGTTGTTTGGATTGTTGCATCAGTATTTGCCCTCACTGTATACCATCCCATCGCTTCCATAGGCTTCTTCAAGTTCGTCGTTATGTTTATCATGATGT TGTCCGATTGGAAGACCTCGAAAAGCTGATTGATTGCTCAAATGTTCAGGCCTATACCATCAATAGTGCGAAAGTGGTGTTTATCAAGAAGAGAGCTCAG AACAGGCAATTCAAAGGGGCCGGAAACTATTGTACTTCCTGTGATAGAAGCCTTCAAGAACCTTTTATCCATTGCTCTCTTGGCTGCAAGGTGGACTTTG TGCTGAAACATTACAAGGACCTTTCTCCATACTTGAGGAGATGCAACGCATTAACTCTTGGTCCTGACTTCTTTATCCCTCAAGATATGGCAGATGATGA GATGACCAATGAGACGCCTCACTCGACAATTGTGGACTCCGATGAGCCGATGAGCTGGTCTTCAAGTTCATCGGGTTCCGAAAACATGAGCATCGCTAGC ACTGGGATTGTACGGAAGAAGAGGAGTGGATTATACGTATGTGCAAGATCATTGAGCAAGGTTTCTGATGAGGACATGGCTTCAAGCATGAGTAGAAGAA AAGGCATCCCTCATCGATCTCCTCTATGTTAG
AA sequence Show only first row Show all	>Potri.018G116000.1 pacid=42800550 polypeptide=Potri.018G116000.1.p locus=Potri.018G116000 ID=Potri.018G116000.1.v4.1 annot-version=v4.1 MGIQKPAWLGALYTQKFFAGCSYHEAAKKNEKNVCCLDCCISICPHCIPSHRFHRLLQVRRYVYHDVVRLEDLEKLIDCSNVQAYTINSAKVVFIKKRAQ NRQFKGAGNYCTSCDRSLQEPFIHCSLGCKVDFVLKHYKDLSPYLRRCNALTLGPDFFIPQDMADDEMTNETPHSTIVDSDEPMSWSSSSSGSENMSIAS TGIVRKKRSGLYVCARSLSKVSDEDMASSMSRRKGIPHRSPLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G12646			PLATZ transcription factor fam...		Potri.018G116000 [exp]	0	1
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.008G156700 [exp]	3.16	0.7719
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Potri.018G021900 [exp]	4.24	0.7598
AT5G16170			Core-2/I-branching beta-1,6-N-...		Potri.004G097700 [exp]	5.91	0.7466
AT5G42340		PUB15	Plant U-Box 15 (.1)		Potri.004G205000 [exp]	6.48	0.7406
AT1G76210			Arabidopsis protein of unknown...		Potri.005G248700 [exp]	7.61	0.6628
AT5G38200			Class I glutamine amidotransfe...		Potri.010G120600 [exp]	8.94	0.7497
AT3G57170			N-acetylglucosaminyl transfera...		Potri.006G044500 [exp]	10.58	0.7264
AT4G24040		TREHALASE1, ATT...	trehalase 1 (.1)		Potri.006G068300 [exp]	13.41	0.6932
					Potri.002G021150 [exp]	15.42	0.6932
AT1G10380			Putative membrane lipoprotein ...		Potri.008G095900 [exp]	19.67	0.7205

Compare expression of checked genes

Potri.018G116000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.