Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49290 66 / 7e-13 ATRLP56 receptor like protein 56 (.1) AT1G54470 64 / 3e-12 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2) AT3G11080 64 / 4e-12 AtRLP35 receptor like protein 35 (.1) AT1G58190 63 / 9e-12 AtRLP9 receptor like protein 9 (.1.2) AT5G27060 60 / 1e-10 AtRLP53 receptor like protein 53 (.1) AT3G05660 60 / 1e-10 AtRLP33 receptor like protein 33 (.1) AT2G25470 58 / 3e-10 AtRLP21 receptor like protein 21 (.1) AT1G74180 58 / 4e-10 AtRLP14 receptor like protein 14 (.1) AT1G74190 56 / 4e-09 AtRLP15 receptor like protein 15 (.1) AT3G11010 52 / 5e-08 AtRLP34 receptor like protein 34 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G117927 [exp] 265 / 9e-83 AT1G07390 429 / 3e-132 receptor like protein 1 (.1.2.3) Potri.018G120827 [exp] 251 / 2e-82 AT1G58190 97 / 4e-21 receptor like protein 9 (.1.2) Potri.018G120800 [exp] 253 / 4e-80 AT1G74190 261 / 2e-74 receptor like protein 15 (.1) Potri.018G118062 [exp] 241 / 5e-74 AT1G74190 421 / 1e-129 receptor like protein 15 (.1) Potri.018G120700 [exp] 196 / 2e-58 AT1G07390 457 / 8e-144 receptor like protein 1 (.1.2.3) Potri.018G118035 [exp] 194 / 1e-57 AT1G07390 465 / 1e-146 receptor like protein 1 (.1.2.3) Potri.006G061300 [exp] 149 / 1e-41 AT2G25470 333 / 4e-99 receptor like protein 21 (.1) Potri.006G061000 [exp] 120 / 1e-31 AT1G74190 286 / 4e-82 receptor like protein 15 (.1) Potri.018G145512 [exp] 119 / 3e-31 AT2G25470 338 / 5e-101 receptor like protein 21 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027856 [exp] 90 / 4e-21 AT1G74190 272 / 1e-77 receptor like protein 15 (.1) Lus10042381 [exp] 81 / 7e-18 AT1G74190 289 / 1e-82 receptor like protein 15 (.1) Lus10030068 [exp] 77 / 1e-16 AT5G49290 397 / 3e-124 receptor like protein 56 (.1) Lus10016341 [exp] 55 / 6e-09 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1) Lus10016324 [exp] 52 / 5e-08 AT4G20140 268 / 9e-78 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1) Lus10002743 [exp] 52 / 5e-08 AT2G34930 476 / 6e-153 disease resistance family protein / LRR family protein (.1) Lus10011577 [exp] 50 / 1e-07 AT5G65700 205 / 4e-60 BARELY ANY MERISTEM 1, Leucine-rich receptor-like protein kinase family protein (.1.2) Lus10002742 [exp] 50 / 2e-07 AT1G58190 399 / 6e-124 receptor like protein 9 (.1.2) Lus10002755 [exp] 50 / 2e-07 AT2G34930 467 / 2e-149 disease resistance family protein / LRR family protein (.1) Lus10002757 [exp] 48 / 3e-07 AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [poplar] [flax] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.018G117954.1 pacid=42800857 polypeptide=Potri.018G117954.1.p locus=Potri.018G117954 ID=Potri.018G117954.1.v4.1 annot-version=v4.1 ATGGGATTCAACAGGTTCTCTCTGCCAGCAGTGGCGGTGATAATGATGATTAATGCCATGCTTCTATCACAAGGGTGTTTCGAGGAAGAACGAATTGCTC TTTTGCAAATCAAAACTTCCTTTCGTGACCACCCAAATGACTTTCCATCCCCGGTACTCTCTTGGGGAAAAGATGCCCTCTGTTGCAGCTGGGAAGGAGT TACCTGCAGCAATTCCACTACAAGACGAGTCATCGAAATCGATCTTTCCTTCGCAAGATATGAGTGGTACTCATCTATGGGAGATTGGTACCTAAATGCA TCTATATTTCTTCCCTTCCAAGAACTCAATGTTCTTGACTTGAGTGAAAATGGCATAGCTGGCTGTGTTGCGAATGAAGGTTTCGAAAGGCTATCAAGAC TTGCAAAATTGGAGGTTCTTTACTTGGGTGACAATAACTTGAACGATAGCATCCTATCATCCCTCAAAGAGCTTTCATCTCTTAAATATCTAAATCTTGG TGGCAATCTGTTGCAAGGATCAATAAACATGAAAGATACTTAG
AA sequence Show only first row Show all	>Potri.018G117954.1 pacid=42800857 polypeptide=Potri.018G117954.1.p locus=Potri.018G117954 ID=Potri.018G117954.1.v4.1 annot-version=v4.1 MGFNRFSLPAVAVIMMINAMLLSQGCFEEERIALLQIKTSFRDHPNDFPSPVLSWGKDALCCSWEGVTCSNSTTRRVIEIDLSFARYEWYSSMGDWYLNA SIFLPFQELNVLDLSENGIAGCVANEGFERLSRLAKLEVLYLGDNNLNDSILSSLKELSSLKYLNLGGNLLQGSINMKDT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G49290		ATRLP56	receptor like protein 56 (.1)		Potri.018G117954 [exp]	0	1
					Potri.004G113000 [exp]	9.79	0.7157
AT1G58190		AtRLP9	receptor like protein 9 (.1.2)		Potri.018G120827 [exp]	18.70	0.7358
AT1G20780		ATPUB44, SAUL1	ARABIDOPSIS THALIANA PLANT U-B...		Potri.010G079200 [exp]	30.00	0.7287
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.004G219600 [exp]	35.28	0.7040
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Potri.005G069500 [exp]	37.74	0.7242
AT3G20600		NDR1	non race-specific disease resi...		Potri.011G133900 [exp]	39.26	0.7236	Pt-NDR1.2
AT3G25010		AtRLP41	receptor like protein 41 (.1)		Potri.012G026900 [exp]	43.63	0.7114
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G026000 [exp]	46.72	0.6641
AT4G35100		SIMIP, PIP3A, P...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.005G109200 [exp]	48.92	0.6976	MDPIP1.5
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.001G128400 [exp]	64.62	0.6290

Compare expression of checked genes

Potri.018G117954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.