Potri.018G119300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G122600 48 / 9e-07 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G119300.2 pacid=42800925 polypeptide=Potri.018G119300.2.p locus=Potri.018G119300 ID=Potri.018G119300.2.v4.1 annot-version=v4.1
ATGAGCGATATGAGCTATAAGCTCTCCTCTCCATCCACATCCAATAGTGGTTATACAGAAAGAGAACTCGTAGGGGCAAAAATGAGTAGCTTGGCTAACG
CCCACGATTTGAGCAATATGAGCTATAAGCTCTCCTCTCCATCCACATCCAATGGTCGTTATACAGAAAGAGACCTCGTAGGGGCAGAGATGAGTTGCTT
AGCTAACGCCCACGATTTGAGCGATTTGAGCTCTAAGCTCTCCTTTCCATCTACATCCAATGGTCGTTATACAGAAAGAGGCCTCGTAGGGGCAGAGATG
AGTTGCTTAGCTAACGCCCACGATTTGATCAATTTGAGCTCTAAGCTCTCCTTTCTATCCACATCCAATGGTCGTTATACAGAAAGAGACCTAGTGGGGG
CAAAAATGAGTTCTCGTAATCCTCTTCATAAATATTCAACATCTGCAAGCCATTCTGTCCATCGCAGCTTAGCTAGTGCATGCCCACAATCCATCCGCAT
GTAA
AA sequence
>Potri.018G119300.2 pacid=42800925 polypeptide=Potri.018G119300.2.p locus=Potri.018G119300 ID=Potri.018G119300.2.v4.1 annot-version=v4.1
MSDMSYKLSSPSTSNSGYTERELVGAKMSSLANAHDLSNMSYKLSSPSTSNGRYTERDLVGAEMSCLANAHDLSDLSSKLSFPSTSNGRYTERGLVGAEM
SCLANAHDLINLSSKLSFLSTSNGRYTERDLVGAKMSSRNPLHKYSTSASHSVHRSLASACPQSIRM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G119300 0 1
AT4G14465 AT-hook AHL20 AT-hook motif nuclear-localize... Potri.010G074201 2.00 0.9580
AT5G51780 bHLH bHLH036 basic helix-loop-helix (bHLH) ... Potri.015G134300 3.46 0.9375
AT4G27745 Yippee family putative zinc-bi... Potri.014G101600 6.32 0.9414
Potri.017G122100 7.74 0.9428
Potri.017G102200 8.00 0.9345
AT5G01750 Protein of unknown function (D... Potri.016G131600 11.83 0.9204
AT3G18710 ATPUB29 ARABIDOPSIS THALIANA PLANT U-B... Potri.002G070500 12.96 0.9122
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Potri.001G036600 13.74 0.9269
AT3G60530 GATA GATA4 GATA transcription factor 4 (.... Potri.014G058600 13.85 0.9159
AT1G51190 AP2_ERF PLT2 PLETHORA 2, Integrase-type DNA... Potri.003G205700 15.65 0.9353 RAP23

Potri.018G119300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.