Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11090 67 / 1e-14 serine-rich protein-related (.1) AT5G20370 61 / 1e-12 serine-rich protein-related (.1) AT5G25280 61 / 2e-12 serine-rich protein-related (.1.2) AT5G55980 42 / 5e-06 serine-rich protein-related (.1) AT1G67910 42 / 5e-06 unknown protein AT1G24577 40 / 1e-05 unknown protein AT3G13227 40 / 2e-05 serine-rich protein-related (.1) AT3G56500 37 / 0.0006 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G060700 [exp] 159 / 5e-52 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.006G258600 [exp] 61 / 2e-12 AT5G25280 181 / 1e-57 serine-rich protein-related (.1.2) Potri.018G023300 [exp] 59 / 8e-12 AT5G11090 194 / 1e-62 serine-rich protein-related (.1) Potri.006G060800 [exp] 59 / 1e-11 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2) Potri.018G120400 [exp] 54 / 9e-10 AT5G11090 126 / 3e-36 serine-rich protein-related (.1) Potri.002G250700 [exp] 40 / 4e-05 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.001G371400 [exp] 40 / 8e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.018G079200 [exp] 38 / 0.0001 AT1G67910 45 / 9e-08 unknown protein Potri.008G186200 [exp] 38 / 0.0002 AT1G67910 85 / 4e-23 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008811 [exp] 81 / 5e-21 AT5G11090 61 / 2e-12 serine-rich protein-related (.1) Lus10038101 [exp] 77 / 2e-19 AT5G11090 54 / 2e-09 serine-rich protein-related (.1) Lus10006660 [exp] 64 / 3e-13 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2) Lus10008808 [exp] 63 / 4e-13 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10039998 [exp] 63 / 4e-13 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10038100 [exp] 62 / 1e-12 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2) Lus10001946 [exp] 60 / 7e-12 AT5G11090 179 / 9e-57 serine-rich protein-related (.1) Lus10001928 [exp] 54 / 7e-10 AT5G11090 177 / 3e-56 serine-rich protein-related (.1) Lus10023632 [exp] 45 / 3e-07 AT1G67910 48 / 1e-08 unknown protein Lus10034901 [exp] 42 / 7e-06 AT1G67910 49 / 6e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G120300.2 pacid=42801691 polypeptide=Potri.018G120300.2.p locus=Potri.018G120300 ID=Potri.018G120300.2.v4.1 annot-version=v4.1 ATGGCATCTAGAAGTGGACCTTGTCCTAAGTCACATACACAGCAAGCAACCAGGACATGCCTGTGTTCACCCACCACACATCCCGGATCATTCAGGTGTG GTCTGCACCGGGATTCCCTTAGGGTGCCTGCCAGATCAAGAATCGGTCGTGCTGGGTCGAATACCAAGGGGGGATTGGCTTTGATTGCCAAAGCAAATTC ATTCAAGGCAATCTTGTTACAGATTATCAAGCCGTCTAGTCATGATCTTCACAGGAGGAGGGATTTCCAGCCAAGGCTTACCAGGTTTTGCCTAATGAAT GCCAGTAGAGATAGGGTTGCTTGTTCTTGA
AA sequence Show only first row Show all	>Potri.018G120300.2 pacid=42801691 polypeptide=Potri.018G120300.2.p locus=Potri.018G120300 ID=Potri.018G120300.2.v4.1 annot-version=v4.1 MASRSGPCPKSHTQQATRTCLCSPTTHPGSFRCGLHRDSLRVPARSRIGRAGSNTKGGLALIAKANSFKAILLQIIKPSSHDLHRRRDFQPRLTRFCLMN ASRDRVACS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G11090			serine-rich protein-related (....		Potri.018G120300 [exp]	0	1
AT4G31860			Protein phosphatase 2C family ...		Potri.003G183800 [exp]	4.24	0.7484
AT3G13677			unknown protein		Potri.001G406200 [exp]	12.24	0.7312
AT4G32330			TPX2 (targeting protein for Xk...		Potri.006G254400 [exp]	19.20	0.7722
AT5G40250			RING/U-box superfamily protein...		Potri.017G072300 [exp]	20.66	0.6729
AT5G15790			RING/U-box superfamily protein...		Potri.003G161600 [exp]	22.97	0.7393
AT5G27020			unknown protein		Potri.013G011950 [exp]	25.23	0.7469
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Potri.009G034700 [exp]	25.98	0.7496
AT4G22680	MYB	ATMYB85	myb domain protein 85 (.1)		Potri.012G127700 [exp]	26.98	0.7334
AT2G47500			P-loop nucleoside triphosphate...		Potri.005G021100 [exp]	28.07	0.7536
AT1G22040			Galactose oxidase/kelch repeat...		Potri.002G091900 [exp]	28.46	0.6795

Compare expression of checked genes

Potri.018G120300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.