Potri.018G120450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G120450.1 pacid=42801551 polypeptide=Potri.018G120450.1.p locus=Potri.018G120450 ID=Potri.018G120450.1.v4.1 annot-version=v4.1
ATGGGCAGTACATTTTGTCTGTCGTCCAAACAGACACCAGTTCCTGAGTCAGCAGCTACTCAGATATCTGACTCATCCCTTTTCTTTTCCTTTCATCTTC
GGATTCTCAGTTTGATGGGAAAGTGCACAAGATTTCAAAGGATTGGATTTCTGTTCTTGCAAGGATTAGTAAATATAATCTCGGTGAGAATCTTACATGA
ATCTAGAAGATAA
AA sequence
>Potri.018G120450.1 pacid=42801551 polypeptide=Potri.018G120450.1.p locus=Potri.018G120450 ID=Potri.018G120450.1.v4.1 annot-version=v4.1
MGSTFCLSSKQTPVPESAATQISDSSLFFSFHLRILSLMGKCTRFQRIGFLFLQGLVNIISVRILHESRR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G120450 0 1
Potri.014G188601 12.24 0.7992
AT3G20190 Leucine-rich repeat protein ki... Potri.007G002000 21.26 0.8484
AT4G24660 ZF_HD ATHB22, MEE68, ... ZINC FINGER HOMEODOMAIN 2, MAT... Potri.019G081300 23.66 0.8550
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Potri.003G131925 24.85 0.8515
AT1G21280 unknown protein Potri.004G127101 42.89 0.8206
AT1G53750 RPT1A regulatory particle triple-A 1... Potri.003G073600 78.14 0.8006
AT5G61340 unknown protein Potri.012G068000 105.49 0.7604
AT5G17200 Pectin lyase-like superfamily ... Potri.012G119700 146.92 0.7888
AT3G47610 transcription regulators;zinc ... Potri.003G168100 150.59 0.7384
AT2G23790 Protein of unknown function (D... Potri.007G031400 156.03 0.7858

Potri.018G120450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.