Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20480 47 / 9e-08 EFR EF-TU receptor (.1) AT3G47110 45 / 1e-06 Leucine-rich repeat protein kinase family protein (.1) AT5G39390 42 / 6e-06 Leucine-rich repeat protein kinase family protein (.1) AT3G47580 41 / 2e-05 Leucine-rich repeat protein kinase family protein (.1) AT3G47090 41 / 2e-05 Leucine-rich repeat protein kinase family protein (.1) AT3G47570 40 / 3e-05 Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G020000 [exp] 100 / 1e-26 AT3G47570 816 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G007866 [exp] 68 / 5e-15 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G033900 [exp] 67 / 2e-14 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.008G034000 [exp] 67 / 2e-14 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.005G080000 [exp] 64 / 2e-13 AT3G47570 818 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G102700 [exp] 61 / 2e-12 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.013G133100 [exp] 59 / 8e-12 AT3G47570 761 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.016G114400 [exp] 59 / 8e-12 AT3G47570 600 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G228200 [exp] 59 / 1e-11 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038598 [exp] 65 / 8e-14 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10037889 [exp] 61 / 1e-12 AT3G47570 248 / 2e-76 Leucine-rich repeat protein kinase family protein (.1) Lus10016896 [exp] 59 / 7e-12 AT3G47570 714 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030855 [exp] 59 / 1e-11 AT3G47570 790 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030903 [exp] 57 / 4e-11 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030851 [exp] 57 / 8e-11 AT3G47570 748 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030847 [exp] 56 / 2e-10 AT3G47570 746 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011387 [exp] 56 / 2e-10 AT3G47570 782 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10030856 [exp] 56 / 2e-10 AT3G47570 763 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10011388 [exp] 56 / 2e-10 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G120901.1 pacid=42800431 polypeptide=Potri.018G120901.1.p locus=Potri.018G120901 ID=Potri.018G120901.1.v4.1 annot-version=v4.1 ATGCTTGAGCAAGAAGTTATGATCTTCACCAGATTTCGTTGCCGAATGTTTCTCAAGGCTCCACATTCATCTATGAAACTCTTAGACGCTCCACGACGTT GCAGGTTAAGAGCTTTGATTGCAACTAGTGTTCCATCTTCATCAATGTCTCCTTTGTACACTGCTAAAATTAACTATCATCTCCAATCAAGTTGTATCTC GGGCAGAGAAAGCAATTTTAGGGGAGATGAGATGCTTAAAAATCTCTAA
AA sequence Show only first row Show all	>Potri.018G120901.1 pacid=42800431 polypeptide=Potri.018G120901.1.p locus=Potri.018G120901 ID=Potri.018G120901.1.v4.1 annot-version=v4.1 MLEQEVMIFTRFRCRMFLKAPHSSMKLLDAPRRCRLRALIATSVPSSSMSPLYTAKINYHLQSSCISGRESNFRGDEMLKNL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47570			Leucine-rich repeat protein ki...		Potri.018G120901 [exp]	0	1
AT5G16100			unknown protein		Potri.006G223100 [exp]	18.76	0.9857
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Potri.011G123200 [exp]	24.45	0.7969
AT2G24370			Protein kinase protein with ad...		Potri.018G002400 [exp]	26.53	0.9856
					Potri.012G055401 [exp]	29.52	0.9185
AT2G48020			Major facilitator superfamily ...		Potri.014G136532 [exp]	30.00	0.9062
AT2G20875		EPF1	epidermal patterning factor 1 ...		Potri.013G136100 [exp]	30.90	0.9542
AT1G01460		ATPIPK11	Phosphatidylinositol-4-phospha...		Potri.014G093300 [exp]	31.38	0.9440
AT4G33230			Plant invertase/pectin methyle...		Potri.003G021300 [exp]	35.07	0.9271
					Potri.001G276804 [exp]	35.09	0.9856
					Potri.001G330250 [exp]	37.52	0.9856

Compare expression of checked genes

Potri.018G120901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.