Potri.018G121700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20400 426 / 6e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G49390 416 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20550 409 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G54000 400 / 8e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 247 / 1e-79 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT1G17010 239 / 2e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25300 237 / 1e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G21420 234 / 2e-74 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G78550 226 / 3e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G38240 219 / 6e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G062500 653 / 0 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G121800 498 / 4e-178 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030400 377 / 1e-130 AT1G49390 320 / 2e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030451 376 / 3e-130 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030500 376 / 3e-130 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G381700 240 / 1e-76 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.001G382400 234 / 1e-74 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Potri.009G022800 233 / 6e-74 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1)
Potri.010G201000 232 / 2e-73 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008824 527 / 0 AT1G49390 410 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10039975 352 / 8e-121 AT1G49390 309 / 5e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008826 336 / 2e-114 AT1G49390 298 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10026173 249 / 3e-80 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10022292 238 / 5e-76 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1)
Lus10006518 238 / 1e-75 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016145 235 / 2e-75 AT5G20550 225 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011980 226 / 2e-71 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10011981 226 / 5e-71 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Lus10011979 224 / 9e-71 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
CL0029 Cupin PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence
>Potri.018G121700.1 pacid=42802001 polypeptide=Potri.018G121700.1.p locus=Potri.018G121700 ID=Potri.018G121700.1.v4.1 annot-version=v4.1
ATGGCTGCCATGGCAGAGTTGATATCAAATTCAGTCCAAGAAATGGCTACCAATGGACAAGAACCACCAGTGAAGTATTTCTCTAAAGGAAATGATGCTG
GAGTCCTTGATGCTCCTGTTCCTTTAATTGAAATCCCAGTTGTTGATCTTGGTCTCCTTACTTCTCCATTAACCAGTGCCCAAGAACTTGAGAAGCTTAA
ATTAGCTCTCAGCTCATGGGGCTGCTTTCAGGTAATAAATCATGGAATGACGAGTTCCTTTTTAGACAAAATTCGTGAAGTTAGCAAGCAATTCTTCGGA
TTTCCGATGGAAGAGAAGCAGAAATACTCCAGAGAAGCTGACAGCATTGAAGGGTATGGAAATGACATGATTCTTTCAGACCACCAAACAGTTGACTGGA
CTGATCGATTGTATCTTACCATTAGCCCAGAAGACCAGAGAAAGATCAAATTTTGGCCCGAAAATCCTAAAGATTTTAGGGAAACCCTACATGAATACAC
CGTGAAGTTACAAGAGACAAATGACTTTCTCCTTAGAGCCATGGCGAGGTCATTGAACTTGGAGGAAAGCTGCTTTCTAGACCAGTATGGAGAACAACCA
CTTGTGACTGCAAGGTTTAACTTCTATCCTCCATGTCCAAGGCCTGATCGAATTCTTGGCGTTAAGCCTCATGCAGATGCTTCGGCAGTTACCTTCCTCT
TGCAAGACAAAGAAGTGGAAGGTCTTCAATTCCTGAAAGACAACGAGTGGTTTAGAGTTCCCATCATTCCACATGCTCTTCTAGTCAATGTCGGAGATCA
AGTAGAGATAATGAGCAATGGAATATTCAAGAGCCCAGTACACAGGGTGGTGACAAACACAGAAAGGGAGAGGAACACTCTGGCTGTATTCTGCATTCCT
GAGTCAGATAATGAAATCAAACCAGCAGATCAGCTGATCAGCGAAACGAGGCCAAGTTTATACAAGAAGGTGAAAGATTATGTTAGTATCTACTTTCAAT
ACTACCAACAAGGGAAACGGCCAATAGAAGCAGTAAAGATTTGA
AA sequence
>Potri.018G121700.1 pacid=42802001 polypeptide=Potri.018G121700.1.p locus=Potri.018G121700 ID=Potri.018G121700.1.v4.1 annot-version=v4.1
MAAMAELISNSVQEMATNGQEPPVKYFSKGNDAGVLDAPVPLIEIPVVDLGLLTSPLTSAQELEKLKLALSSWGCFQVINHGMTSSFLDKIREVSKQFFG
FPMEEKQKYSREADSIEGYGNDMILSDHQTVDWTDRLYLTISPEDQRKIKFWPENPKDFRETLHEYTVKLQETNDFLLRAMARSLNLEESCFLDQYGEQP
LVTARFNFYPPCPRPDRILGVKPHADASAVTFLLQDKEVEGLQFLKDNEWFRVPIIPHALLVNVGDQVEIMSNGIFKSPVHRVVTNTERERNTLAVFCIP
ESDNEIKPADQLISETRPSLYKKVKDYVSIYFQYYQQGKRPIEAVKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20400 2-oxoglutarate (2OG) and Fe(II... Potri.018G121700 0 1
AT2G22590 UDP-Glycosyltransferase superf... Potri.012G034100 2.82 0.9053
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283204 4.69 0.9198
AT2G23520 Pyridoxal phosphate (PLP)-depe... Potri.005G131300 5.19 0.8755
AT2G25180 GARP ARR12 response regulator 12 (.1) Potri.018G021300 5.29 0.8750 ARR12.2
AT5G03700 D-mannose binding lectin prote... Potri.008G016900 6.48 0.9152
AT3G26040 HXXXD-type acyl-transferase fa... Potri.010G056300 7.34 0.8816
AT3G14420 Aldolase-type TIM barrel famil... Potri.004G065200 10.29 0.8676
AT4G31340 myosin heavy chain-related (.1... Potri.006G076700 10.58 0.8667
AT2G33590 NAD(P)-binding Rossmann-fold s... Potri.005G257700 11.22 0.8636
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283400 12.24 0.9146 LEC.4

Potri.018G121700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.