Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49390 107 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 97 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G54000 97 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20550 96 / 2e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 65 / 8e-14 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 62 / 5e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G17010 61 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 60 / 3e-12 ATSRG1, SRG1 senescence-related gene 1 (.1) AT1G78550 59 / 6e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 58 / 3e-11 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G121700 [exp] 140 / 4e-42 AT5G20400 426 / 8e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G062500 [exp] 130 / 3e-38 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G121800 [exp] 116 / 7e-33 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030451 [exp] 85 / 5e-21 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030500 [exp] 85 / 5e-21 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G030400 [exp] 79 / 5e-19 AT1G49390 320 / 2e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G062400 [exp] 77 / 9e-19 AT5G20400 129 / 1e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 64 / 2e-13 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.010G201000 [exp] 63 / 3e-13 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008824 [exp] 115 / 2e-32 AT1G49390 410 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008826 [exp] 94 / 2e-24 AT1G49390 298 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10039975 [exp] 92 / 7e-24 AT1G49390 309 / 5e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022292 [exp] 68 / 9e-15 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10042493 [exp] 62 / 2e-13 AT1G17020 242 / 4e-80 senescence-related gene 1 (.1) Lus10026173 [exp] 63 / 4e-13 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10011987 [exp] 63 / 6e-13 AT1G78550 284 / 1e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032574 [exp] 62 / 7e-13 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10016145 [exp] 61 / 3e-12 AT5G20550 225 / 2e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015153 [exp] 59 / 7e-12 AT1G05010 501 / 1e-180 ethylene forming enzyme, ethylene-forming enzyme (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.018G121750.1 pacid=42801303 polypeptide=Potri.018G121750.1.p locus=Potri.018G121750 ID=Potri.018G121750.1.v4.1 annot-version=v4.1 ATGGCGAGGTCATGGAACTTGGAGGAAGGCTGCTTTCTAGACCAGTATGGAGAACAGCCACTTGTGACTGCAAGGTTCAACTTCTATCCTCCATGTCCAA GGCCTGATCGAATTCTTGGCGTTAAGCCTCATGCAGATGCATCGGCAGTTACCTTCCTCTTGCAAGACAAAGAAGTGGAAGGTCTTCAATTCCTGAAAGC AACGAGTGGTTTAGAGTTCCCATCATTCCACATGCTCATATGTAAAGTCAACCGGTAG
AA sequence Show only first row Show all	>Potri.018G121750.1 pacid=42801303 polypeptide=Potri.018G121750.1.p locus=Potri.018G121750 ID=Potri.018G121750.1.v4.1 annot-version=v4.1 MARSWNLEEGCFLDQYGEQPLVTARFNFYPPCPRPDRILGVKPHADASAVTFLLQDKEVEGLQFLKATSGLEFPSFHMLICKVNR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Potri.018G121750 [exp]	0	1
					Potri.005G038350 [exp]	3.16	0.8426
AT3G09440			Heat shock protein 70 (Hsp 70)...		Potri.008G054766 [exp]	15.00	0.7356
AT2G35635		UBQ7, RUB2	RELATED TO UBIQUITIN 2, ubiqui...		Potri.005G011700 [exp]	15.62	0.7231
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Potri.017G125500 [exp]	40.00	0.7080
AT3G46620			zinc finger (C3HC4-type RING f...		Potri.006G164516 [exp]	44.27	0.7547
AT5G10530			Concanavalin A-like lectin pro...		Potri.007G004300 [exp]	50.95	0.7474
AT5G17680			disease resistance protein (TI...		Potri.019G070700 [exp]	55.74	0.7618
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211532 [exp]	74.89	0.7091
AT4G27220			NB-ARC domain-containing disea...		Potri.001G404875 [exp]	91.22	0.7432
AT3G06880			Transducin/WD40 repeat-like su...		Potri.008G220800 [exp]	91.53	0.7242

Compare expression of checked genes

Potri.018G121750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.