Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04550 94 / 3e-23 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT4G28640 94 / 7e-23 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT4G32280 92 / 2e-22 AUX_IAA IAA29 indole-3-acetic acid inducible 29 (.1) AT2G33310 92 / 2e-22 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT1G51950 80 / 9e-18 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1) AT1G04100 77 / 7e-17 AUX_IAA IAA10 indoleacetic acid-induced protein 10 (.1) AT1G15580 73 / 6e-16 AUX_IAA ATAUX2-27, IAA5 AUXIN-INDUCIBLE 2-27, indole-3-acetic acid inducible 5 (.1) AT3G16500 74 / 1e-15 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) AT5G43700 71 / 3e-15 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT4G29080 73 / 4e-15 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G066600 [exp] 385 / 1e-137 AT4G28640 104 / 3e-27 indole-3-acetic acid inducible 11 (.1.2.3) Potri.006G255200 [exp] 169 / 3e-52 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.010G065200 [exp] 82 / 2e-18 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.002G045000 [exp] 79 / 6e-18 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G172400 [exp] 81 / 1e-17 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.008G161100 [exp] 79 / 1e-17 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 78 / 1e-17 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G186400 [exp] 77 / 2e-17 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.005G053900 [exp] 78 / 4e-17 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024853 [exp] 86 / 4e-20 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10023719 [exp] 84 / 1e-18 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10018764 [exp] 82 / 1e-18 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014464 [exp] 83 / 2e-18 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10001501 [exp] 77 / 3e-17 AT1G04100 81 / 9e-19 indoleacetic acid-induced protein 10 (.1) Lus10039488 [exp] 77 / 4e-17 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 77 / 4e-17 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 77 / 5e-17 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10022868 [exp] 78 / 6e-17 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10024854 [exp] 76 / 2e-16 AT3G04730 221 / 3e-72 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF02309 [poplar] [flax] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Potri.018G127800.1 pacid=42801594 polypeptide=Potri.018G127800.1.p locus=Potri.018G127800 ID=Potri.018G127800.1.v4.1 annot-version=v4.1 ATGGAACTTCAACTTGGTCTCGGTCTCCCAAGTGAGAAAACAATGAAGGGTTTAGACCTAAACAGCTATGTTTCTGAGCCTAAAGGGTTGCTGGGCTCGG GACAACTTCAACTGGGTCAATATTCATGGTTTTCTACGAATGCTAATGACAAGAAACGGAGTTTTATTGATGCCTTTGAAGAGAGCTCAGGAAATGAAGA TGGGCCTCAAACGTTACCTCTCTTGGTTTGGAATAACCAGCCAAACGACGAAGATGATTTCCCTAAAGATCTCGACAACCATAGTAGCAACTCTTGTGCC TCCAACAAAAGTGATGGAGAAAGTGATTGGATAGTGGGGTGGCCACCAATAAAGTTCAAGAAGAAGAAGCTTAGTCGTCAAAGCAGCAGGGCGCTAGAGA TCAATCGGGCAGTGGACAATGGTTATGAAGATTGCCAAGCTAGAACATCAAAGTATATGTACATTAAGGTCAAGATGGAGGGGGTAGGAATAGCAAGGAA AATTGATGTTAGCCTCCACCATTCTTTTCCAACACTCAAGCAGACCTTGCTTGACATGTTTGGGATATGCCAGGAAAATTCAAGCAACTACAGACTGACT TACCAGGATAGAGAAGGTGACTGGCTACTAGCTGAAGATGTACCTTGGAGGAACTTTCTTGGGACAGTCCAACTACTAAAATTGATGAGGAGAAGCAGCT GA
AA sequence Show only first row Show all	>Potri.018G127800.1 pacid=42801594 polypeptide=Potri.018G127800.1.p locus=Potri.018G127800 ID=Potri.018G127800.1.v4.1 annot-version=v4.1 MELQLGLGLPSEKTMKGLDLNSYVSEPKGLLGSGQLQLGQYSWFSTNANDKKRSFIDAFEESSGNEDGPQTLPLLVWNNQPNDEDDFPKDLDNHSSNSCA SNKSDGESDWIVGWPPIKFKKKKLSRQSSRALEINRAVDNGYEDCQARTSKYMYIKVKMEGVGIARKIDVSLHHSFPTLKQTLLDMFGICQENSSNYRLT YQDREGDWLLAEDVPWRNFLGTVQLLKLMRRSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G04550	AUX_IAA	BDL, IAA12	indole-3-acetic acid inducible...		Potri.018G127800 [exp]	0	1
AT1G14685	BBR_BPC	BBR/BPC2, ATBPC...	basic pentacysteine 2 (.1.2.3)		Potri.015G032900 [exp]	6.70	0.8057	Pt-GBP.7
AT3G03980			NAD(P)-binding Rossmann-fold s...		Potri.019G033500 [exp]	8.48	0.7716
					Potri.013G037900 [exp]	12.04	0.7736
AT4G13010			Oxidoreductase, zinc-binding d...		Potri.001G343000 [exp]	16.79	0.7790
AT3G47300		SELT	SELT-like protein precursor (....		Potri.001G253000 [exp]	17.43	0.7757
AT2G27490		ATCOAE	dephospho-CoA kinase family (....		Potri.008G053601 [exp]	31.08	0.7546
AT3G52360			unknown protein		Potri.016G066200 [exp]	34.07	0.7528
					Potri.018G104801 [exp]	34.52	0.7539
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.004G027900 [exp]	35.91	0.7466
AT3G17860	ZIM	TIFY6B, JAI3, J...	JASMONATE-INSENSITIVE 3, jasmo...		Potri.008G133400 [exp]	39.57	0.6977

Compare expression of checked genes

Potri.018G127800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.