Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20180 132 / 3e-41 Ribosomal protein L36 (.1.2) ATCG00760 37 / 0.0001 ATCG00760.1, RPL36 ribosomal protein L36 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G069000 [exp] 175 / 3e-58 AT5G20180 125 / 3e-39 Ribosomal protein L36 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043268 [exp] 123 / 4e-37 AT5G20180 105 / 8e-31 Ribosomal protein L36 (.1.2) Lus10019412 [exp] 120 / 2e-36 AT5G20180 114 / 2e-34 Ribosomal protein L36 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00444 [poplar] [flax] Ribosomal_L36 Ribosomal protein L36
Representative CDS sequence Show only first row Show all	>Potri.018G131000.1 pacid=42801294 polypeptide=Potri.018G131000.1.p locus=Potri.018G131000 ID=Potri.018G131000.1.v4.1 annot-version=v4.1 ATGATATCAAGCTCTCCCATTTCTCTCCCTCAACAGTCCCATTCGTTTGGTTTCAACACACCCATTATTCTCCAGACGCTTCGCCACAACCCCACAATCG TAGCCATGAAGGTGAGGTCATCAGTGAAAAAGATGTGTGAGTTTTGTCAGATAGTTAAGCGTCGTGGACGGATATATGTAATCTGTAGTTCTAATCCCAA GCACAAGCAACGTCAAGGCTTTGCAACATTTGCTTACAGTGGCCTCATATCTGCGGAGACCACTGCCCCACCGAGAATTGTACCCAGTCAAAGCATGGGA ATAGGCCTGGCTTCTCTCTTACCCAAAAAGTATGAACCAACAACCATGTATGGATGGAGGGCTGGCCTTTCATCTTTCCTCTTCAAACAAGGGAATTAG
AA sequence Show only first row Show all	>Potri.018G131000.1 pacid=42801294 polypeptide=Potri.018G131000.1.p locus=Potri.018G131000 ID=Potri.018G131000.1.v4.1 annot-version=v4.1 MISSSPISLPQQSHSFGFNTPIILQTLRHNPTIVAMKVRSSVKKMCEFCQIVKRRGRIYVICSSNPKHKQRQGFATFAYSGLISAETTAPPRIVPSQSMG IGLASLLPKKYEPTTMYGWRAGLSSFLFKQGN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20180			Ribosomal protein L36 (.1.2)		Potri.018G131000 [exp]	0	1
AT2G34480			Ribosomal protein L18ae/LX fam...		Potri.004G063400 [exp]	7.28	0.7071
AT2G34480			Ribosomal protein L18ae/LX fam...		Potri.004G063300 [exp]	11.13	0.6633	RPL18.6
AT5G13780			Acyl-CoA N-acyltransferases (N...		Potri.001G261800 [exp]	14.79	0.6574
AT3G55820			Fasciclin-like arabinogalactan...		Potri.010G192300 [exp]	20.97	0.6097
AT5G15750			Alpha-L RNA-binding motif/Ribo...		Potri.017G101200 [exp]	21.16	0.6569
AT3G02650			Tetratricopeptide repeat (TPR)...		Potri.001G361500 [exp]	29.49	0.6417
AT1G64550		SCORD5, AtGCN20...	susceptible to coronatine-defi...		Potri.001G087300 [exp]	42.44	0.5728	GCN3.1
AT3G13230			RNA-binding KH domain-containi...		Potri.001G469200 [exp]	45.00	0.6104
AT4G15770			RNA binding (.1)		Potri.010G024400 [exp]	48.90	0.6110
AT5G48240			unknown protein		Potri.014G170500 [exp]	49.47	0.6096

Compare expression of checked genes

Potri.018G131000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.