Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) AT1G77370 130 / 4e-40 Glutaredoxin family protein (.1) AT5G63030 96 / 2e-26 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G40370 93 / 2e-25 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT2G20270 92 / 2e-24 Thioredoxin superfamily protein (.1.2) AT4G28730 89 / 3e-23 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT2G47870 63 / 9e-14 Thioredoxin superfamily protein (.1) AT3G21460 62 / 1e-13 Glutaredoxin family protein (.1) AT3G62960 61 / 5e-13 Thioredoxin superfamily protein (.1) AT4G15700 61 / 6e-13 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G017300 [exp] 131 / 3e-40 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.002G254100 [exp] 96 / 7e-26 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.001G347700 [exp] 91 / 1e-24 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.012G082800 [exp] 91 / 3e-24 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.015G078900 [exp] 90 / 4e-24 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.002G208500 [exp] 66 / 5e-15 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1) Potri.014G134200 [exp] 66 / 8e-15 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1) Potri.002G208400 [exp] 64 / 3e-14 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 63 / 2e-13 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017148 [exp] 185 / 2e-61 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10021590 [exp] 183 / 2e-60 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10028355 [exp] 129 / 3e-39 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1) Lus10022253 [exp] 105 / 4e-30 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 103 / 1e-29 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10042104 [exp] 90 / 8e-24 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10001237 [exp] 89 / 1e-23 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10022844 [exp] 88 / 1e-22 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10011915 [exp] 69 / 2e-15 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10033965 [exp] 63 / 1e-13 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.018G133400.1 pacid=42801798 polypeptide=Potri.018G133400.1.p locus=Potri.018G133400 ID=Potri.018G133400.1.v4.1 annot-version=v4.1 ATGGCGACGAGGATAAGATTGCCATCAATCTTGGCTACAGCAGTAACATTAACAGTACTTGCAGCATCACTCACCTGGGCTGCTGGCAGCCCTGAAGCTA CTTTTGTCAAAAAGACCATCTCTTCTCATCAGATCGTCATCTTCTCCAAGTCTTATTGCCCGTATTGTAAGAAGGCTAAAGGTGTTTTCAAAGAACTGAA CCAGACACCACATGTTGTCGAGCTCGATCAAAGAGAGGATGGGCACGACATTCAGGATGCCATGAGTGAAATTGTTGGGAGGCGCACCGTGCCTCAGGTT TTCATAGACGGGAAGCACATTGGTGGCTCAGATGACACCGTGGAAGCATACGAAAGTGGAGAACTTGCTAAGCTTTTAGGAGTTGCTTCAGAGCAGAAAG ATGATCTCTAA
AA sequence Show only first row Show all	>Potri.018G133400.1 pacid=42801798 polypeptide=Potri.018G133400.1.p locus=Potri.018G133400 ID=Potri.018G133400.1.v4.1 annot-version=v4.1 MATRIRLPSILATAVTLTVLAASLTWAAGSPEATFVKKTISSHQIVIFSKSYCPYCKKAKGVFKELNQTPHVVELDQREDGHDIQDAMSEIVGRRTVPQV FIDGKHIGGSDDTVEAYESGELAKLLGVASEQKDDL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20500			Glutaredoxin family protein (....		Potri.018G133400 [exp]	0	1
AT5G66410		PLP3B	phosducin-like protein 3 homol...		Potri.007G020400 [exp]	1.41	0.9344
AT3G04780			Protein of unknown function (D...		Potri.013G039500 [exp]	2.23	0.9390
AT1G47420		SDH5	succinate dehydrogenase 5 (.1)		Potri.014G032400 [exp]	2.44	0.9335
AT1G10030		ERG28	homolog of yeast ergosterol28 ...		Potri.002G112700 [exp]	3.87	0.9005
AT5G59613			unknown protein		Potri.008G053000 [exp]	6.00	0.9160
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Potri.015G059100 [exp]	6.00	0.9095
AT5G18800			Cox19-like CHCH family protein...		Potri.008G196600 [exp]	6.00	0.9281
AT1G51650			ATP synthase epsilon chain, mi...		Potri.010G250000 [exp]	6.63	0.9334
AT4G37830			cytochrome c oxidase-related (...		Potri.007G008800 [exp]	7.07	0.9333
AT1G76200			unknown protein		Potri.005G248600 [exp]	8.30	0.8889

Compare expression of checked genes

Potri.018G133400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.