Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17220 112 / 3e-29 Kin3 kinase 3, Protein kinase superfamily protein (.1.2) AT4G35600 109 / 3e-28 Kin4, CX32, CST, CONNEXIN 32, CONNEXIN32 kinase 4, CONNEXIN 32, CAST AWAY, Protein kinase superfamily protein (.1.2) AT1G76360 104 / 3e-26 Protein kinase superfamily protein (.1) AT2G02800 100 / 9e-25 Kin2, APK2B protein kinase 2B (.1.2) AT5G47070 98 / 4e-24 Protein kinase superfamily protein (.1) AT1G61590 97 / 1e-23 Protein kinase superfamily protein (.1) AT3G55450 96 / 2e-23 PBL1 PBS1-like 1 (.1.2) AT1G69790 96 / 3e-23 Protein kinase superfamily protein (.1) AT1G14370 96 / 3e-23 Kin1, PBL2, APK2A PBS1-like 2, kinase 1, protein kinase 2A (.1) AT2G28930 95 / 7e-23 APK1B protein kinase 1B (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G138401 [exp] 212 / 1e-67 AT2G17220 342 / 2e-115 kinase 3, Protein kinase superfamily protein (.1.2) Potri.006G072100 [exp] 182 / 9e-56 AT2G17220 343 / 6e-115 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G135001 [exp] 174 / 3e-54 AT2G17220 184 / 1e-55 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G135300 [exp] 174 / 7e-53 AT2G17220 358 / 1e-121 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G134100 [exp] 157 / 5e-46 AT2G17220 386 / 6e-132 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G133801 [exp] 152 / 2e-44 AT2G17220 372 / 1e-126 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G138900 [exp] 125 / 2e-34 AT2G17220 391 / 2e-134 kinase 3, Protein kinase superfamily protein (.1.2) Potri.018G138700 [exp] 123 / 4e-33 AT2G17220 377 / 4e-128 kinase 3, Protein kinase superfamily protein (.1.2) Potri.004G206100 [exp] 120 / 5e-32 AT2G17220 539 / 0.0 kinase 3, Protein kinase superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026546 [exp] 120 / 2e-31 AT4G38270 899 / 0.0 galacturonosyltransferase 3 (.1.2) Lus10013832 [exp] 120 / 3e-31 AT2G17140 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10001392 [exp] 117 / 7e-31 AT2G17220 537 / 0.0 kinase 3, Protein kinase superfamily protein (.1.2) Lus10024512 [exp] 116 / 1e-30 AT4G35600 483 / 4e-170 kinase 4, CONNEXIN 32, CAST AWAY, Protein kinase superfamily protein (.1.2) Lus10008015 [exp] 116 / 2e-30 AT4G35600 464 / 2e-162 kinase 4, CONNEXIN 32, CAST AWAY, Protein kinase superfamily protein (.1.2) Lus10023000 [exp] 115 / 3e-30 AT2G17220 538 / 0.0 kinase 3, Protein kinase superfamily protein (.1.2) Lus10012256 [exp] 108 / 1e-27 AT1G76360 499 / 1e-175 Protein kinase superfamily protein (.1) Lus10016020 [exp] 107 / 3e-27 AT1G76360 493 / 2e-173 Protein kinase superfamily protein (.1) Lus10030496 [exp] 105 / 6e-27 AT2G02800 551 / 0.0 protein kinase 2B (.1.2) Lus10012850 [exp] 105 / 1e-26 AT2G02800 614 / 0.0 protein kinase 2B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.018G134501.1 pacid=42801813 polypeptide=Potri.018G134501.1.p locus=Potri.018G134501 ID=Potri.018G134501.1.v4.1 annot-version=v4.1 ATGTTTGTTTTCTGTGCAGTATTTAGAAGAGAATTAAAACAAGTAATCAGCTTACCTTTCAACATCTACAAGGGTTTGCTCAAAGAAAAGTTACTTAAAG GATATACCAGGAAACGGCGGATTGCTGTCAAGAAATTGGATTCTGACAGCAAGCAAGGTCTTCGACAGTGGCAGACAGAGGTCGGTTTCTTAGCAAGGGT TTCTCATCCAAACATTGTAAAGCTGCTAGGATACTGTCAGGAAAATGCGAATAAAGAGTTGCTTATTGTCTATCAATTCATGGAGAAAGGCAGTTTAAAT TACCATTTGTTTGGAAAGCGCTCTGATCGGCTTCTTCCTTGGGAAACAAGGTTAAAGATTATAACAGGAATGGCTCGAGCCCTATCTTATTTGCATACAA TTGAAGGCAAGAAGGCTTTAAATTTGTTCTCGAAATCAGATGCTTCATTTTTTCTGGGTACTATTGCCTCTTTTAACATCTGGTTCTGTATGGCAACCAC AAATTTTTTAGCACAGTTGTCTCTATCAAGTGGTGTATTTGCAGCCATGCGGGGAAACAAGGTCACCGAGGACAGAGAATTCCCTGTTTCACCAGATGAA GAGGAACCTTGA
AA sequence Show only first row Show all	>Potri.018G134501.1 pacid=42801813 polypeptide=Potri.018G134501.1.p locus=Potri.018G134501 ID=Potri.018G134501.1.v4.1 annot-version=v4.1 MFVFCAVFRRELKQVISLPFNIYKGLLKEKLLKGYTRKRRIAVKKLDSDSKQGLRQWQTEVGFLARVSHPNIVKLLGYCQENANKELLIVYQFMEKGSLN YHLFGKRSDRLLPWETRLKIITGMARALSYLHTIEGKKALNLFSKSDASFFLGTIASFNIWFCMATTNFLAQLSLSSGVFAAMRGNKVTEDREFPVSPDE EEP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G17220		Kin3	kinase 3, Protein kinase super...		Potri.018G134501 [exp]	0	1
AT2G28160	bHLH	ATFIT1, ATBHLH2...	ARABIDOPSIS FE-DEFICIENCY INDU...		Potri.009G005600 [exp]	4.69	0.9734
AT5G04950		ATNAS1	ARABIDOPSIS THALIANA NICOTIANA...		Potri.004G193400 [exp]	8.83	0.9703
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.015G006000 [exp]	10.58	0.9685
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177601 [exp]	11.61	0.9648
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Potri.003G088800 [exp]	13.03	0.9576
AT1G71140			MATE efflux family protein (.1...		Potri.019G075800 [exp]	15.81	0.8710
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	16.09	0.9623
AT2G01900			DNAse I-like superfamily prote...		Potri.010G101700 [exp]	16.79	0.9624
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Potri.004G156300 [exp]	18.33	0.9609
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	18.49	0.9595

Compare expression of checked genes

Potri.018G134501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.