Potri.018G136502 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145560 64 / 6e-14 AT5G08450 801 / 0.0 unknown protein
Potri.018G145546 62 / 3e-13 AT5G08450 386 / 8e-129 unknown protein
Potri.T044400 62 / 4e-13 AT5G08450 523 / 7e-176 unknown protein
Potri.T044700 54 / 3e-10 AT5G08450 796 / 0.0 unknown protein
Potri.004G135800 50 / 7e-09 AT5G08450 860 / 0.0 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G136502.1 pacid=42802236 polypeptide=Potri.018G136502.1.p locus=Potri.018G136502 ID=Potri.018G136502.1.v4.1 annot-version=v4.1
ATGGAAAAGAATCTGCTGGTGGACGTGCAGAAGGTGAAATTGCAACTGAAAGGGAAAGAGAAGAATTTAACTATTGAGTCCAGCATCGCAAGAGGATGCT
TCAGCCTAGGGCCAGCCCGCAAGTGGCAAATCGCAAAACCCGTTTTAGGTCCCATACTCAAGACAGTGAGGGGAGCTAAGTGTCCAGAGATCTATCCGTC
ATGA
AA sequence
>Potri.018G136502.1 pacid=42802236 polypeptide=Potri.018G136502.1.p locus=Potri.018G136502 ID=Potri.018G136502.1.v4.1 annot-version=v4.1
MEKNLLVDVQKVKLQLKGKEKNLTIESSIARGCFSLGPARKWQIAKPVLGPILKTVRGAKCPEIYPS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G08450 unknown protein Potri.018G136502 0 1
AT2G34930 disease resistance family prot... Potri.003G196766 92.83 0.6045
Potri.006G071401 125.21 0.6028
AT4G14480 Protein kinase superfamily pro... Potri.004G194700 127.94 0.5787

Potri.018G136502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.