Potri.018G136900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33420 451 / 1e-160 Peroxidase superfamily protein (.1)
AT5G42180 288 / 2e-96 PER64 peroxidase 64, Peroxidase superfamily protein (.1)
AT5G51890 278 / 1e-92 Peroxidase superfamily protein (.1)
AT3G03670 256 / 8e-84 Peroxidase superfamily protein (.1)
AT4G11290 254 / 2e-83 Peroxidase superfamily protein (.1)
AT1G05260 254 / 4e-83 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT5G17820 250 / 1e-81 Peroxidase superfamily protein (.1)
AT4G36430 249 / 2e-81 Peroxidase superfamily protein (.1)
AT5G39580 246 / 4e-80 Peroxidase superfamily protein (.1.2)
AT5G64120 245 / 2e-79 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T045500 645 / 0 AT4G33420 441 / 9e-157 Peroxidase superfamily protein (.1)
Potri.004G134800 571 / 0 AT4G33420 457 / 3e-163 Peroxidase superfamily protein (.1)
Potri.005G108900 294 / 5e-99 AT5G42180 442 / 2e-157 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.002G018000 270 / 1e-89 AT5G42180 483 / 1e-173 peroxidase 64, Peroxidase superfamily protein (.1)
Potri.005G195600 265 / 3e-87 AT1G71695 460 / 4e-163 Peroxidase superfamily protein (.1)
Potri.002G065300 265 / 3e-87 AT1G71695 468 / 2e-166 Peroxidase superfamily protein (.1)
Potri.014G143200 261 / 3e-86 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.007G122451 255 / 2e-83 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.005G195700 254 / 7e-83 AT1G71695 453 / 2e-160 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029543 463 / 3e-165 AT4G33420 479 / 1e-171 Peroxidase superfamily protein (.1)
Lus10034547 288 / 2e-96 AT5G42180 471 / 7e-169 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10017288 287 / 3e-96 AT5G42180 462 / 4e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10005614 286 / 1e-95 AT5G42180 461 / 6e-165 peroxidase 64, Peroxidase superfamily protein (.1)
Lus10027405 277 / 3e-92 AT5G51890 448 / 2e-159 Peroxidase superfamily protein (.1)
Lus10031664 276 / 9e-92 AT5G51890 453 / 1e-161 Peroxidase superfamily protein (.1)
Lus10010634 265 / 6e-87 AT1G44970 449 / 5e-159 Peroxidase superfamily protein (.1)
Lus10018374 256 / 5e-84 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
Lus10027164 253 / 1e-82 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039680 252 / 2e-82 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.018G136900.2 pacid=42801300 polypeptide=Potri.018G136900.2.p locus=Potri.018G136900 ID=Potri.018G136900.2.v4.1 annot-version=v4.1
ATGGCTACGGCTAATTTTCTTGCTTTGTTTTTATTGATGGAGTTAATAGCAGGTGGTTATAGAGATGGAGCGAATGGCCTCAGCATGAACTATTACGTTT
TCAGCTGCCCATTTGCTGAGGCAATTGTGAGGAACACAGTAACAAGTGCTTTGAAGTCTGATCCTACCTTAGCAGCTGGTCTTGTTAGAATGCATTTCCA
TGATTGCTGGATACAAGGATGTGATGGGTCTGTGCTGATAGACTCAACAAAGGATAACACAGCAGAGAAGGAATCTCCAGGAAATCAAAGCGTGAGAGGC
TTTGAACTCATTGATGATGTAAAGGAGCAACTTGAAGAGCAATGCCCTGGTGTTGTCTCATGCGCTGACATTGTTGCAATGGCTGCTAGAGAGGCTGTTG
CTTTGTCAGGAGGTCCAGTTTATGACATACCAAAAGGAAGAAAAGATGGAAGGAGGTCTAAAATTGAAGATACTCTCAGTGCGCCTGCTCCAACTTTTAA
TGCCTCGGAGCTCGTTAGAGTCTTTGGCCTCCGTGGTTTTAGTGCCCAAGACATGGTTGCCTTGTCTGGGGGGCACACACTAGGGGTGGCAAGGTGTTTA
ACGTTCAAAAATAGGTTGAGTGACCCTGTTGATCCGACTATGGATTCAGACTTTTCAAAGACTTTGTCCAAAACATGTAGTGGTGGAGACGATGCAGAAC
AAACATTTGATATGACAAGAAATAATTTTGATAACTTCTACTTCCAAGCATTGCAGAGGAAATCAGGAGTTCTTTTTTCAGACCAAACCCTATACAATAA
TCCAAGAACAAAATCAATTGTCAAAGACTACGCTATGAACCAGGCTAAGTTTTTCCTTGATTTTCAACAGGCAATGGTGAAAATGAGCTTGCTCGATGTC
AAGGAGGGATCACAAGGAGAAGTAAGAGCAGATTGTCGTAAAATTAACTGA
AA sequence
>Potri.018G136900.2 pacid=42801300 polypeptide=Potri.018G136900.2.p locus=Potri.018G136900 ID=Potri.018G136900.2.v4.1 annot-version=v4.1
MATANFLALFLLMELIAGGYRDGANGLSMNYYVFSCPFAEAIVRNTVTSALKSDPTLAAGLVRMHFHDCWIQGCDGSVLIDSTKDNTAEKESPGNQSVRG
FELIDDVKEQLEEQCPGVVSCADIVAMAAREAVALSGGPVYDIPKGRKDGRRSKIEDTLSAPAPTFNASELVRVFGLRGFSAQDMVALSGGHTLGVARCL
TFKNRLSDPVDPTMDSDFSKTLSKTCSGGDDAEQTFDMTRNNFDNFYFQALQRKSGVLFSDQTLYNNPRTKSIVKDYAMNQAKFFLDFQQAMVKMSLLDV
KEGSQGEVRADCRKIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G33420 Peroxidase superfamily protein... Potri.018G136900 0 1
AT2G33550 Trihelix Homeodomain-like superfamily p... Potri.001G066900 3.46 0.8501
AT5G12300 Calcium-dependent lipid-bindin... Potri.009G070400 4.58 0.8458
AT2G42430 AS2 ASL18, LBD16 ASYMMETRIC LEAVES2-LIKE 18, la... Potri.005G221900 6.24 0.8249 LBD16.3
AT5G23750 Remorin family protein (.1.2) Potri.015G143600 7.21 0.8535
AT1G77460 Armadillo/beta-catenin-like re... Potri.002G081101 7.87 0.8591
Potri.008G084200 8.94 0.8156
AT4G35160 O-methyltransferase family pro... Potri.019G102900 9.79 0.8565 COMTL3,Pt-GSI.2
AT5G20260 Exostosin family protein (.1) Potri.006G064900 10.48 0.8128
AT1G52080 AR791 actin binding protein family (... Potri.001G191300 12.44 0.7970
AT4G33565 RING/U-box superfamily protein... Potri.007G111900 16.49 0.8187

Potri.018G136900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.