Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-HSP17.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07400 116 / 7e-34 HSP20-like chaperones superfamily protein (.1) AT1G59860 103 / 8e-29 HSP20-like chaperones superfamily protein (.1) AT2G19310 101 / 8e-28 HSP20-like chaperones superfamily protein (.1) AT1G53540 100 / 2e-27 HSP20-like chaperones superfamily protein (.1) AT3G46230 96 / 1e-25 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1) AT5G59720 89 / 8e-23 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1) AT2G29500 85 / 2e-21 HSP20-like chaperones superfamily protein (.1) AT5G37670 60 / 3e-12 HSP15.7CI HSP20-like chaperones superfamily protein (.1) AT4G10250 57 / 1e-10 ATHSP22.0 HSP20-like chaperones superfamily protein (.1) AT4G25200 54 / 4e-09 ATHSP23.6-MITO mitochondrion-localized small heat shock protein 23.6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G073500 [exp] 270 / 1e-94 AT1G07400 113 / 2e-32 HSP20-like chaperones superfamily protein (.1) Potri.009G147900 [exp] 121 / 8e-36 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1) Potri.004G187450 [exp] 120 / 2e-35 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1) Potri.009G039200 [exp] 117 / 5e-34 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1) Potri.009G148000 [exp] 115 / 3e-33 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1) Potri.019G081250 [exp] 114 / 7e-33 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1) Potri.004G187400 [exp] 111 / 9e-32 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1) Potri.009G049800 [exp] 110 / 1e-31 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1) Potri.004G187202 [exp] 110 / 1e-31 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040723 [exp] 101 / 8e-28 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1) Lus10016458 [exp] 97 / 3e-26 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1) Lus10040722 [exp] 93 / 1e-24 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1) Lus10016457 [exp] 92 / 5e-24 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1) Lus10016456 [exp] 91 / 1e-23 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1) Lus10009085 [exp] 85 / 3e-21 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1) Lus10040830 [exp] 67 / 1e-14 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1) Lus10026262 [exp] 66 / 1e-13 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1) Lus10042408 [exp] 65 / 2e-13 AT4G10250 154 / 1e-47 HSP20-like chaperones superfamily protein (.1) Lus10004039 [exp] 62 / 7e-13 AT5G37670 150 / 3e-48 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [poplar] [flax] HSP20 PF00011 [poplar] [flax] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Potri.018G140600.1 pacid=42801984 polypeptide=Potri.018G140600.1.p locus=Potri.018G140600 ID=Potri.018G140600.1.v4.1 annot-version=v4.1 ATGTCAATAGTCCCAATTGGTAACCAAGGCGGTGCAATCACAAATCCCGCCTCTTTAGACACATGGGATCCTGAAGACTTCTTCACTTCACTGGATCTTT GGGACCCATTTCAAAACTTCCCATTCCCTTCCTTGTTTTCCACTCACTTTCCTGCCTTTCCAACGCAAACCCAAGTGAACTGGAAGGAAACATCAAGGGC CCATGTGTTCAGAGCTGTGTTTCCTGGGTTTGGTAGAGAAGATGTGCTTGTTTATATTGATGATGATGATATGCTTCAAATAAGTACCGAGGATGGTAAG TTCATGAGCAAATTCAAGTTGCCTGATAATGCTAGAAGGGATCAGATTAAGGCTGATATGGTGAATGGAGTGCTTGCTGTTACTATTCCTAAGCAAGAAG TTGCCAGTTATAGGCCCGATGTTAGGGTTGTTGAGATTGAAGGTTCTGACTGA
AA sequence Show only first row Show all	>Potri.018G140600.1 pacid=42801984 polypeptide=Potri.018G140600.1.p locus=Potri.018G140600 ID=Potri.018G140600.1.v4.1 annot-version=v4.1 MSIVPIGNQGGAITNPASLDTWDPEDFFTSLDLWDPFQNFPFPSLFSTHFPAFPTQTQVNWKETSRAHVFRAVFPGFGREDVLVYIDDDDMLQISTEDGK FMSKFKLPDNARRDQIKADMVNGVLAVTIPKQEVASYRPDVRVVEIEGSD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07400			HSP20-like chaperones superfam...		Potri.018G140600 [exp]	0	1	Pt-HSP17.2
AT3G13570		SCL30A, At-SCL3...	SC35-like splicing factor 30A ...		Potri.016G062500 [exp]	1.00	0.8907
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Potri.013G079700 [exp]	8.30	0.7878	NAC152
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Potri.001G151800 [exp]	10.95	0.7991	ATBI.1
AT1G64585		RTFL22, DVL12	DEVIL 12, ROTUNDIFOLIA like 22...		Potri.002G173750 [exp]	12.24	0.8158
AT2G23090			Uncharacterised protein family...		Potri.009G090800 [exp]	12.96	0.8420
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Potri.003G082700 [exp]	15.93	0.8528
AT3G56740			Ubiquitin-associated (UBA) pro...		Potri.016G035800 [exp]	16.52	0.8272
AT2G20280	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.006G132800 [exp]	19.64	0.7254
AT2G24830	C3HZnF		zinc finger (CCCH-type) family...		Potri.018G016200 [exp]	21.90	0.7537
AT1G67360			Rubber elongation factor prote...		Potri.001G055300 [exp]	22.91	0.7559

Compare expression of checked genes

Potri.018G140600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.