Potri.018G143500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57230 274 / 7e-96 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G076300 301 / 7e-107 AT5G57230 263 / 1e-91 Thioredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003582 261 / 1e-90 AT5G57230 264 / 6e-92 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.018G143500.1 pacid=42801150 polypeptide=Potri.018G143500.1.p locus=Potri.018G143500 ID=Potri.018G143500.1.v4.1 annot-version=v4.1
ATGGAGGAGAAATCATTTTTGGATAGAATGCTTGGTCATCTACGAGAAACATGCAAGTACTATACTGGGTATCCTAAATATCTTGGGCCATCACGGGTTA
TTCACTTTACGTCAGAGCGTGAGTTTGTCCAACTTCTTCACCAAGGCTACCCGGTGGTTGTTGCTTTTACCATCAGAGGCAATTACACCAAACACCTAGA
CCGTGTTCTTGAGGAAGCTGCTGCTGAGTTTTATCCACATGTAAAAGTTTTGCGTGTTGAATGTCCAAAATATCCTGGTTTTTGTATAACACGGCAGAGG
AAGGAATATCCATTCATTGAAATATTTCATAGCCCAGAACAAGCAGCTAACCAGGGAAGGGTTGCTGATCCAAATATCACAAAATACTCTGTGAAGGTTC
TACCTTTCAACTATGACCAGAGTGCTTATGGATTCAGAGAATTTTTCAAGCGCCATGGCATTCGATCGTCACCAGATCCAAAGTAA
AA sequence
>Potri.018G143500.1 pacid=42801150 polypeptide=Potri.018G143500.1.p locus=Potri.018G143500 ID=Potri.018G143500.1.v4.1 annot-version=v4.1
MEEKSFLDRMLGHLRETCKYYTGYPKYLGPSRVIHFTSEREFVQLLHQGYPVVVAFTIRGNYTKHLDRVLEEAAAEFYPHVKVLRVECPKYPGFCITRQR
KEYPFIEIFHSPEQAANQGRVADPNITKYSVKVLPFNYDQSAYGFREFFKRHGIRSSPDPK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G57230 Thioredoxin superfamily protei... Potri.018G143500 0 1
AT1G69980 unknown protein Potri.010G039466 4.24 0.7808
AT1G52740 HTA9 histone H2A protein 9 (.1) Potri.018G032100 4.69 0.7785
AT4G30240 Syntaxin/t-SNARE family protei... Potri.006G168800 4.89 0.8101
AT3G23580 RNR2A ribonucleotide reductase 2A (.... Potri.008G201500 7.34 0.7361 RNR2.1
AT5G61930 APO3 ACCUMULATION OF PHOTOSYSTEM ON... Potri.015G106200 7.48 0.7746
Potri.010G139550 10.53 0.8012
AT2G32300 UCC1 uclacyanin 1 (.1) Potri.006G009000 12.44 0.6795
AT4G20960 Cytidine/deoxycytidylate deami... Potri.002G158800 15.49 0.7597
AT5G07820 Plant calmodulin-binding prote... Potri.012G067100 19.39 0.7997
AT2G47710 Adenine nucleotide alpha hydro... Potri.008G221300 20.49 0.7801

Potri.018G143500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.