Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01900 75 / 6e-17 DNAse I-like superfamily protein (.1) AT1G05470 67 / 3e-14 CVP2 COTYLEDON VASCULAR PATTERN 2, DNAse I-like superfamily protein (.1) AT2G32010 64 / 2e-13 CVL1 CVP2 like 1 (.1.2) AT5G04980 61 / 4e-12 DNAse I-like superfamily protein (.1.2) AT5G65090 60 / 8e-12 DER4, MRH3, BST1 DEFORMED ROOT HAIRS 4, BRISTLED 1, DNAse I-like superfamily protein (.1.2) AT4G18010 59 / 2e-11 AT5PTASE2, IP5PII INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2) AT2G37440 58 / 3e-11 DNAse I-like superfamily protein (.1.2) AT3G63240 57 / 8e-11 DNAse I-like superfamily protein (.1) AT1G71710 56 / 3e-10 DNAse I-like superfamily protein (.1.2) AT1G34120 54 / 9e-10 AT5PTASE1, ATIP5PI, AT5P1, IP5PI MYO-INOSITOL POLYPHOSPHATE 5-PHOSPHATASE 1, inositol polyphosphate 5-phosphatase I (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G032200 [exp] 85 / 1e-20 AT2G01900 476 / 1e-166 DNAse I-like superfamily protein (.1) Potri.012G041600 [exp] 83 / 8e-20 AT2G01900 472 / 3e-165 DNAse I-like superfamily protein (.1) Potri.016G101966 [exp] 72 / 8e-18 AT2G01900 52 / 5e-09 DNAse I-like superfamily protein (.1) Potri.010G101700 [exp] 71 / 1e-15 AT2G01900 537 / 0.0 DNAse I-like superfamily protein (.1) Potri.008G139600 [exp] 69 / 6e-15 AT2G01900 521 / 0.0 DNAse I-like superfamily protein (.1) Potri.010G084300 [exp] 66 / 8e-14 AT2G32010 865 / 0.0 CVP2 like 1 (.1.2) Potri.008G155700 [exp] 66 / 1e-13 AT2G32010 914 / 0.0 CVP2 like 1 (.1.2) Potri.002G050000 [exp] 65 / 2e-13 AT3G63240 785 / 0.0 DNAse I-like superfamily protein (.1) Potri.001G145900 [exp] 64 / 2e-13 AT4G18010 615 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006904 [exp] 65 / 2e-13 AT3G63240 711 / 0.0 DNAse I-like superfamily protein (.1) Lus10006597 [exp] 65 / 2e-13 AT2G32010 581 / 0.0 CVP2 like 1 (.1.2) Lus10039352 [exp] 65 / 2e-13 AT2G32010 894 / 0.0 CVP2 like 1 (.1.2) Lus10014684 [exp] 63 / 1e-12 AT3G63240 635 / 0.0 DNAse I-like superfamily protein (.1) Lus10042619 [exp] 62 / 2e-12 AT3G63240 587 / 0.0 DNAse I-like superfamily protein (.1) Lus10040107 [exp] 62 / 3e-12 AT4G18010 638 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2) Lus10003010 [exp] 61 / 7e-12 AT4G18010 655 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2) Lus10025305 [exp] 57 / 1e-10 AT2G37440 481 / 8e-167 DNAse I-like superfamily protein (.1.2) Lus10024427 [exp] 57 / 1e-10 AT2G37440 489 / 2e-162 DNAse I-like superfamily protein (.1.2) Lus10011041 [exp] 56 / 2e-10 AT4G18010 655 / 0.0 INOSITOL\(1,4,5\)P3 5-PHOSPHATASE II, myo-inositol polyphosphate 5-phosphatase 2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G144101.1 pacid=42802013 polypeptide=Potri.018G144101.1.p locus=Potri.018G144101 ID=Potri.018G144101.1.v4.1 annot-version=v4.1 ATGAAGGGTGAAAAGAAGCATGCTCCTGCTTGGTGTGATCCAATAATTTGTTTTGGAGAGGGACTGAAGCAGCAAGAATTCAGCAGAGGTGAATCGAGAT TGTCAGACCATAGACCTGTTCGCGCAATCTTCGTAGCAGAATCCGATGTCTCAAGTGATTCCAGGAGTTTGGGAAGCTCCTTTACAGGCAGTTTTAATTT CTTACAAGACCTTTTCAAGAGTGCTTTAATAATAAGATATCATGTAATGTCAGAACGAGCTCCTATTCTGAAAAATTCTACCAGTTTATTTCAAAAAACA AATTGTTATACTTGA
AA sequence Show only first row Show all	>Potri.018G144101.1 pacid=42802013 polypeptide=Potri.018G144101.1.p locus=Potri.018G144101 ID=Potri.018G144101.1.v4.1 annot-version=v4.1 MKGEKKHAPAWCDPIICFGEGLKQQEFSRGESRLSDHRPVRAIFVAESDVSSDSRSLGSSFTGSFNFLQDLFKSALIIRYHVMSERAPILKNSTSLFQKT NCYT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G01900			DNAse I-like superfamily prote...		Potri.018G144101 [exp]	0	1
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Potri.015G132800 [exp]	6.00	0.9395	Pt-CYP96.4,CYP96A16v2
AT3G55646			unknown protein		Potri.008G061700 [exp]	6.92	0.9400
					Potri.001G227750 [exp]	20.37	0.9332
AT4G18250			receptor serine/threonine kina...		Potri.017G009600 [exp]	22.44	0.9198
					Potri.018G131900 [exp]	23.32	0.9110
					Potri.008G151550 [exp]	26.92	0.9007
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Potri.014G047900 [exp]	35.49	0.8474	Pt-DAD1.3
AT1G73850			Protein of unknown function (D...		Potri.015G046900 [exp]	43.54	0.9196
AT5G24810			ABC1 family protein (.1.2)		Potri.006G276600 [exp]	45.24	0.9012
AT1G22150		SULTR1;3	sulfate transporter 1;3 (.1)		Potri.005G167300 [exp]	45.29	0.9161

Compare expression of checked genes

Potri.018G144101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.