Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34400 85 / 4e-20 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G30700 49 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16860 47 / 8e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G36730 47 / 9e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G42920 46 / 2e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G48910 46 / 2e-06 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G59200 45 / 3e-06 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G37310 45 / 5e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G44880 44 / 6e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G38010 44 / 6e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G147873 [exp] 203 / 9e-69 AT2G34400 168 / 5e-50 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145514 [exp] 209 / 7e-67 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G064301 [exp] 192 / 1e-64 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041650 [exp] 177 / 6e-57 AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041501 [exp] 177 / 7e-57 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.012G108000 [exp] 184 / 7e-56 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145510 [exp] 178 / 5e-55 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G144960 [exp] 145 / 3e-46 AT2G34400 122 / 7e-34 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G063709 [exp] 107 / 3e-31 AT2G34400 112 / 3e-30 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010320 [exp] 119 / 4e-32 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10035815 [exp] 56 / 1e-09 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037387 [exp] 51 / 3e-08 AT3G56550 700 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10041326 [exp] 49 / 2e-07 AT3G56550 702 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017446 [exp] 49 / 3e-07 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010909 [exp] 46 / 1e-06 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002552 [exp] 46 / 1e-06 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1) Lus10010385 [exp] 46 / 2e-06 AT4G37380 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033026 [exp] 46 / 2e-06 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024971 [exp] 45 / 3e-06 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G144401.1 pacid=42801917 polypeptide=Potri.018G144401.1.p locus=Potri.018G144401 ID=Potri.018G144401.1.v4.1 annot-version=v4.1 ATGGCATTCCAAGTGACAACATCCTTGTTTGGCATTGAATCAAAGACCCTCCTCACACATATCAAATCCCCACACTTACCATACATGACAATCAAGGCAG ACCCCACATACGAATTTACCTCCATCTTCTTCTCCAAAACAAGCCCCTCCACCCATCTCCCCAAACCCAAATCCCCACACGCCCCAAGAACATTCACCAA CGTCATCTCATCTGGCTCAAACCCCTCCTCCCTCATTTCCATAAACAACCCAATTGCCTCTTTAGCAAAACCCATCTTAGAATACCCAGAAATCATCGAA TTCCACGACACCAAGTCTCTGTCACCCATTTCATCAAACACCTTCCGTGCAAACCCCATTTCACCACAACTTGCGTCCATTGTAGTCAAAGAATGA
AA sequence Show only first row Show all	>Potri.018G144401.1 pacid=42801917 polypeptide=Potri.018G144401.1.p locus=Potri.018G144401 ID=Potri.018G144401.1.v4.1 annot-version=v4.1 MAFQVTTSLFGIESKTLLTHIKSPHLPYMTIKADPTYEFTSIFFSKTSPSTHLPKPKSPHAPRTFTNVISSGSNPSSLISINNPIASLAKPILEYPEIIE FHDTKSLSPISSNTFRANPISPQLASIVVKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G144401 [exp]	0	1
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.001G063709 [exp]	4.00	0.8480
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.001G064301 [exp]	5.47	0.8190
AT5G43230			unknown protein		Potri.010G057700 [exp]	17.43	0.7883
AT3G43660			Vacuolar iron transporter (VIT...		Potri.018G106000 [exp]	26.90	0.6745
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Potri.011G101700 [exp]	28.46	0.7052
					Potri.012G067350 [exp]	30.98	0.8126
					Potri.012G059801 [exp]	35.51	0.7641
AT3G14680		CYP72A14	"cytochrome P450, family 72, s...		Potri.011G101750 [exp]	36.93	0.7167
AT2G23090			Uncharacterised protein family...		Potri.014G018400 [exp]	43.26	0.7874
AT5G38560		AtPERK8	proline-rich extensin-like rec...		Potri.004G105200 [exp]	46.21	0.7731

Compare expression of checked genes

Potri.018G144401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.