Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34400 66 / 9e-14 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT2G37310 49 / 5e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G11290 44 / 6e-06 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G08070 42 / 2e-05 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G35130 42 / 2e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22410 41 / 4e-05 SLO1 SLOW GROWTH 1 (.1) AT3G26540 41 / 5e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G37170 40 / 6e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G16835 40 / 7e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G33760 40 / 8e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G147873 [exp] 157 / 2e-51 AT2G34400 168 / 5e-50 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G144401 [exp] 150 / 2e-48 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G064301 [exp] 144 / 8e-46 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145514 [exp] 152 / 3e-45 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041650 [exp] 130 / 4e-39 AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.012G108000 [exp] 136 / 9e-39 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041501 [exp] 129 / 3e-38 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145510 [exp] 131 / 1e-37 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G063709 [exp] 110 / 3e-33 AT2G34400 112 / 3e-30 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010320 [exp] 82 / 3e-19 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10002552 [exp] 46 / 5e-07 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1) Lus10018492 [exp] 44 / 3e-06 AT4G18750 385 / 2e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039703 [exp] 44 / 4e-06 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027366 [exp] 43 / 9e-06 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029853 [exp] 43 / 1e-05 AT1G09190 575 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10001852 [exp] 42 / 2e-05 AT1G05750 309 / 5e-103 pigment defective 247, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004751 [exp] 42 / 2e-05 AT5G55740 577 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025273 [exp] 42 / 2e-05 AT2G37310 635 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10007840 [exp] 42 / 2e-05 AT5G55740 579 / 0.0 chlororespiratory reduction 21, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G144960.1 pacid=42802081 polypeptide=Potri.018G144960.1.p locus=Potri.018G144960 ID=Potri.018G144960.1.v4.1 annot-version=v4.1 ATGTCAATCAAGGCAGACCCCACATACGAATTTACCTACATCTTCTTCTCCAAAACAAGCCCCTCCACCCATCTCCCCAAACCCAAATCCCCACACCCCC CAAGAACATTCACCAGCGTCATCTCATCTGGCTCAAACCCCTCCTCCCTCATTTCCATAAACAACCAAATTGCCTCTTTAGCAAAACCCATCTTAGAATA CCCCGAAATCATCGAATTCCACGACACCAAGTCTCTGTCACCCATTTCATCAAACACCTTCCGTGCAAACCCCATTTCACCACACCTTGCGTCCTTTGTA GTCAAAGAATGA
AA sequence Show only first row Show all	>Potri.018G144960.1 pacid=42802081 polypeptide=Potri.018G144960.1.p locus=Potri.018G144960 ID=Potri.018G144960.1.v4.1 annot-version=v4.1 MSIKADPTYEFTYIFFSKTSPSTHLPKPKSPHPPRTFTSVISSGSNPSSLISINNQIASLAKPILEYPEIIEFHDTKSLSPISSNTFRANPISPHLASFV VKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G144960 [exp]	0	1
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G147873 [exp]	3.46	0.7215
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041650 [exp]	6.32	0.5890
AT5G43210			Excinuclease ABC, C subunit, N...		Potri.001G259216 [exp]	12.48	0.5665
AT5G43210			Excinuclease ABC, C subunit, N...		Potri.001G259900 [exp]	22.13	0.5654
					Potri.003G109500 [exp]	27.22	0.5064
AT5G11720			Glycosyl hydrolases family 31 ...		Potri.011G154300 [exp]	35.00	0.5709
AT5G06100	MYB	ATMYB33	myb domain protein 33 (.1.2.3)		Potri.013G130900 [exp]	105.56	0.4928
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041501 [exp]	110.95	0.4801
AT3G12620			Protein phosphatase 2C family ...		Potri.008G046900 [exp]	112.53	0.4577
AT1G12400			Nucleotide excision repair, TF...		Potri.001G116000 [exp]	174.61	0.4656

Compare expression of checked genes

Potri.018G144960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.