Potri.018G145502 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
AT1G64220 69 / 3e-17 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G146602 109 / 3e-33 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Potri.006G077500 103 / 3e-31 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001641 84 / 2e-23 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Lus10007843 77 / 1e-20 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Lus10004754 77 / 1e-20 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Lus10000059 77 / 2e-20 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Lus10016473 77 / 2e-20 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Lus10040758 76 / 3e-20 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08038 Tom7 TOM7 family
Representative CDS sequence
>Potri.018G145502.1 pacid=42800408 polypeptide=Potri.018G145502.1.p locus=Potri.018G145502 ID=Potri.018G145502.1.v4.1 annot-version=v4.1
ATGGCGTCTAGGGTTTCTCTAAAGACGAAAGGCAAGAGCAGCAGCGGCAAGGGAGCAAAAGGTGTGGAAGAGAAGTCAGCATCACAGTATGTCAAAGAAT
GGAGCACATGGACATTTAAGAAGGCGAAAGTAATCACACACTATGGATTCATTCCTATGATTATCATCATTGGAATGCATTCTGAGCCTGAACCCCAGAT
TTATCAGCTCCTTAGTCCCTTCTGA
AA sequence
>Potri.018G145502.1 pacid=42800408 polypeptide=Potri.018G145502.1.p locus=Potri.018G145502 ID=Potri.018G145502.1.v4.1 annot-version=v4.1
MASRVSLKTKGKSSSGKGAKGVEEKSASQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMHSEPEPQIYQLLSPF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G41685 Mitochondrial outer membrane t... Potri.018G145502 0 1
AT1G48560 unknown protein Potri.003G188600 3.74 0.7699
AT5G41685 Mitochondrial outer membrane t... Potri.018G146602 4.24 0.7711
AT4G30850 HHP2 heptahelical transmembrane pr... Potri.018G102400 4.47 0.7950
AT3G25500 AHF1, AFH1, ATF... ARABIDOPSIS THALIANA FORMIN HO... Potri.014G174700 7.87 0.7209
AT5G59480 Haloacid dehalogenase-like hyd... Potri.001G242300 8.77 0.7612
AT3G18650 MADS AGL103 AGAMOUS-like 103 (.1) Potri.008G020300 8.94 0.7364
AT2G36070 ATTIM44-2 translocase inner membrane sub... Potri.005G224500 9.27 0.7099 ATTIM44.2
AT4G03390 SRF3 STRUBBELIG-receptor family 3 (... Potri.013G144600 10.29 0.7047
AT2G16390 DMS1, CHR35, DR... DEFECTIVE IN RNA-DIRECTED DNA ... Potri.004G159000 12.24 0.7882
AT3G47610 transcription regulators;zinc ... Potri.003G168100 23.23 0.7671

Potri.018G145502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.