Potri.018G145520 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54470 67 / 2e-13 RPP27 resistance to Peronospora parasitica 27, RNI-like superfamily protein (.1.2)
AT1G74180 64 / 1e-12 AtRLP14 receptor like protein 14 (.1)
AT5G49290 64 / 2e-12 ATRLP56 receptor like protein 56 (.1)
AT1G58190 62 / 1e-11 AtRLP9 receptor like protein 9 (.1.2)
AT2G25470 56 / 8e-10 AtRLP21 receptor like protein 21 (.1)
AT1G74190 54 / 4e-09 AtRLP15 receptor like protein 15 (.1)
AT3G53240 52 / 3e-08 AtRLP45 receptor like protein 45 (.1)
AT3G11080 45 / 9e-06 AtRLP35 receptor like protein 35 (.1)
AT5G53890 44 / 2e-05 AtPSKR2 phytosylfokine-alpha receptor 2 (.1)
AT5G23400 44 / 2e-05 Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G063500 256 / 4e-89 AT1G58190 71 / 8e-15 receptor like protein 9 (.1.2)
Potri.001G065318 200 / 3e-65 AT1G74190 81 / 1e-16 receptor like protein 15 (.1)
Potri.001G063909 203 / 2e-61 AT1G74190 333 / 3e-99 receptor like protein 15 (.1)
Potri.003G041600 197 / 4e-59 AT1G74170 333 / 2e-98 receptor like protein 13 (.1)
Potri.018G145512 196 / 6e-59 AT2G25470 338 / 5e-101 receptor like protein 21 (.1)
Potri.001G065327 194 / 3e-58 AT1G07390 352 / 3e-105 receptor like protein 1 (.1.2.3)
Potri.001G064900 194 / 5e-58 AT1G07390 290 / 7e-83 receptor like protein 1 (.1.2.3)
Potri.018G148000 194 / 5e-58 AT1G74190 354 / 1e-106 receptor like protein 15 (.1)
Potri.018G144300 193 / 8e-58 AT2G25470 348 / 8e-105 receptor like protein 21 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030068 72 / 2e-15 AT5G49290 397 / 3e-124 receptor like protein 56 (.1)
Lus10027856 71 / 1e-14 AT1G74190 272 / 1e-77 receptor like protein 15 (.1)
Lus10042381 60 / 4e-11 AT1G74190 289 / 1e-82 receptor like protein 15 (.1)
Lus10016338 52 / 2e-08 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1)
Lus10016339 51 / 6e-08 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10016337 50 / 1e-07 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1)
Lus10002757 47 / 3e-07 AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1)
Lus10001035 49 / 4e-07 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1)
Lus10016340 48 / 9e-07 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
Lus10002753 48 / 9e-07 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Potri.018G145520.1 pacid=42801684 polypeptide=Potri.018G145520.1.p locus=Potri.018G145520 ID=Potri.018G145520.1.v4.1 annot-version=v4.1
ATGGGGCTGTTCCTTCAGATGTTGATGGTTTTAGTGATGATGGCTTCCTTGCAAGGATGGCTGCCTCTTTGTTGCTTGGGGGAAGAGAGAATCGCTCTCT
TGCAGCTCAAAGATGCTCTTCACTATCCCAATGGCACATCCCTACCCTCCTGGATAAAAGGCCACGCTCACTGTTGTGATTGGGAAAGTATTATCTGCAG
CAGCAGTACAGGTCGAGTCACCGCACTCGTTCTTGACAGCACAAGGAATCAGGAACTGGGAGATTGGTACTTAAATGCCTCATTGTTTCTTCCTTTCCAA
GAACTCGACGCTCTTTACTTGTCAGATAATCTTATAGCTGGTTGGGTTAAGAACAAAGATAGTTATGAACTACTGAGATTGAGCAATTTGGAGCACCTTG
ACTTGAGATATAATTGCTTCGATAACAGTTGTCGCACGTATGCGGCATCACGGTGA
AA sequence
>Potri.018G145520.1 pacid=42801684 polypeptide=Potri.018G145520.1.p locus=Potri.018G145520 ID=Potri.018G145520.1.v4.1 annot-version=v4.1
MGLFLQMLMVLVMMASLQGWLPLCCLGEERIALLQLKDALHYPNGTSLPSWIKGHAHCCDWESIICSSSTGRVTALVLDSTRNQELGDWYLNASLFLPFQ
ELDALYLSDNLIAGWVKNKDSYELLRLSNLEHLDLRYNCFDNSCRTYAASR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G54470 RPP27 resistance to Peronospora para... Potri.018G145520 0 1
AT2G01260 Protein of unknown function (D... Potri.019G119100 6.32 0.7492
AT3G56630 CYP94D2 "cytochrome P450, family 94, s... Potri.001G277301 6.48 0.7111
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Potri.001G312650 27.85 0.7013
Potri.016G022050 29.17 0.6101
AT1G32700 PLATZ transcription factor fam... Potri.005G130300 59.49 0.6426
Potri.018G060100 60.96 0.6425
AT5G64260 EXL2, MSJ1.10 EXORDIUM like 2 (.1) Potri.014G126000 92.17 0.6287
AT5G34930 arogenate dehydrogenase (.1) Potri.008G074500 100.14 0.6136

Potri.018G145520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.