Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63350 43 / 8e-06 Disease resistance protein (CC-NBS-LRR class) family (.1) AT1G12290 43 / 1e-05 Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) AT4G19050 42 / 2e-05 NB-ARC domain-containing disease resistance protein (.1) AT4G27220 40 / 0.0001 NB-ARC domain-containing disease resistance protein (.1) AT4G10780 39 / 0.0003 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G63360 37 / 0.0009 Disease resistance protein (CC-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T013500 [exp] 129 / 8e-40 AT1G12220 54 / 6e-09 RESISTANT TO P. SYRINGAE 5, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2) Potri.018G145562 [exp] 131 / 4e-37 AT4G27220 224 / 1e-62 NB-ARC domain-containing disease resistance protein (.1) Potri.T044800 [exp] 129 / 3e-36 AT4G27220 310 / 3e-91 NB-ARC domain-containing disease resistance protein (.1) Potri.T045375 [exp] 124 / 2e-34 AT4G27220 290 / 3e-85 NB-ARC domain-containing disease resistance protein (.1) Potri.018G145566 [exp] 118 / 2e-32 AT4G27220 348 / 7e-105 NB-ARC domain-containing disease resistance protein (.1) Potri.019G013140 [exp] 117 / 4e-32 AT4G27220 294 / 1e-84 NB-ARC domain-containing disease resistance protein (.1) Potri.018G145538 [exp] 113 / 4e-32 AT4G27220 57 / 6e-09 NB-ARC domain-containing disease resistance protein (.1) Potri.018G136700 [exp] 117 / 5e-32 AT4G27190 323 / 4e-94 NB-ARC domain-containing disease resistance protein (.1) Potri.018G135600 [exp] 116 / 9e-32 AT4G27220 338 / 7e-100 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G145534.1 pacid=42801639 polypeptide=Potri.018G145534.1.p locus=Potri.018G145534 ID=Potri.018G145534.1.v4.1 annot-version=v4.1 ATGGAGAGCTTGGCTTCATCTCCTTGGTTTTGGTCTGGTCCACTAACATTGGCATCTTATAATGGTATATTTTCTGGTCTTGAGGAGTTCTATTGTTTTG GATGTACAAGTATGAAGAAGTTGTTCCCTCTTGTCTTCCTGCCAGACCTAGAAGTGATTGAAGTTAGTAATTGTGAGAAAATGGAGGAGATAATAGAAAC AAGATCAGATGATGAAGGGCTTATCGGTGAACTCGAACTTCCAAAGTTGAGAGATTTGAAATTGATTGAATTACCAGAATTGAAAAGTATTTTTAGTGAA TAA
AA sequence Show only first row Show all	>Potri.018G145534.1 pacid=42801639 polypeptide=Potri.018G145534.1.p locus=Potri.018G145534 ID=Potri.018G145534.1.v4.1 annot-version=v4.1 MESLASSPWFWSGPLTLASYNGIFSGLEEFYCFGCTSMKKLFPLVFLPDLEVIEVSNCEKMEEIIETRSDDEGLIGELELPKLRDLKLIELPELKSIFSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G63350			Disease resistance protein (CC...		Potri.018G145534 [exp]	0	1
AT4G27190			NB-ARC domain-containing disea...		Potri.018G145556 [exp]	2.44	0.8009
AT5G36930			Disease resistance protein (TI...		Potri.003G014200 [exp]	6.32	0.8062
AT5G61580		PFK4	phosphofructokinase 4 (.1.2)		Potri.001G079501 [exp]	10.95	0.7532
AT1G28760			Uncharacterized conserved prot...		Potri.019G039300 [exp]	15.49	0.6921
AT1G05430			unknown protein		Potri.008G154200 [exp]	19.62	0.7402
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Potri.001G285900 [exp]	20.97	0.6993
					Potri.012G030301 [exp]	24.43	0.7621
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Potri.012G043000 [exp]	25.39	0.7052	Pt-SKOR.2
					Potri.001G103200 [exp]	48.18	0.6900
AT4G37210			Tetratricopeptide repeat (TPR)...		Potri.002G130800 [exp]	55.85	0.6536

Compare expression of checked genes

Potri.018G145534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.