Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07650 116 / 2e-31 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29720 115 / 3e-31 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53430 110 / 2e-29 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53440 110 / 2e-29 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29730 107 / 3e-28 Leucine-rich repeat transmembrane protein kinase (.1) AT3G14840 107 / 3e-28 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53420 105 / 1e-27 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29750 101 / 3e-26 RKF1 receptor-like kinase in flowers 1 (.1.2) AT1G29740 100 / 8e-26 Leucine-rich repeat transmembrane protein kinase (.1) AT3G09010 77 / 9e-18 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T013750 [exp] 160 / 2e-52 AT1G07650 94 / 1e-06 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.004G135500 [exp] 131 / 1e-36 AT1G07650 1324 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.001G385200 [exp] 118 / 3e-32 AT3G14840 1171 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G106400 [exp] 115 / 3e-31 AT1G53440 1268 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.004G063900 [exp] 114 / 4e-31 AT1G07650 477 / 2e-159 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G072666 [exp] 115 / 5e-31 AT1G29740 926 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.004G063600 [exp] 114 / 5e-31 AT1G07650 479 / 4e-160 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G073516 [exp] 114 / 5e-31 AT1G29730 644 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G073316 [exp] 113 / 6e-31 AT1G07650 487 / 4e-164 Leucine-rich repeat transmembrane protein kinase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031374 [exp] 119 / 2e-32 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10041937 [exp] 114 / 8e-31 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005550 [exp] 114 / 8e-31 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10010951 [exp] 112 / 4e-30 AT1G07650 979 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10042505 [exp] 109 / 8e-29 AT1G53440 1013 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005418 [exp] 104 / 3e-27 AT1G29750 800 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10015239 [exp] 104 / 3e-27 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10038153 [exp] 103 / 1e-26 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10042851 [exp] 78 / 4e-18 AT1G16670 429 / 3e-149 Protein kinase superfamily protein (.1) Lus10028149 [exp] 77 / 2e-17 AT1G16670 434 / 6e-152 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.018G145536.1 pacid=42801299 polypeptide=Potri.018G145536.1.p locus=Potri.018G145536 ID=Potri.018G145536.1.v4.1 annot-version=v4.1 ATGAAAGCTGCCACCAAGAACTTCGATGCAGCAAACAATGTCGGGGAGGGTGATTTTGCTTCTGTTTTCAAGGGTTCGTTATCAGATGGAACTGTGATTG CAGTGATGCTGCTTTCCTCAAAATCTAAGCAAGGAAACCGTGAATTTGTGAATGAGATAGGAATGATATCTGCACTGCAACATCCAAATCCTTGTAAAGT TGTATGGATGTTGTGTTGGAGGAAACCAATTTATGCTTGTGTCGTGTACATGGAAAACAATTGCCGGTCCCGTGCTCTATTTGGGATTCTGCCAGGCCTA TGTTTTGCAAGAGAGAGGAAGTCTTTCCGAGGTGGTTGA
AA sequence Show only first row Show all	>Potri.018G145536.1 pacid=42801299 polypeptide=Potri.018G145536.1.p locus=Potri.018G145536 ID=Potri.018G145536.1.v4.1 annot-version=v4.1 MKAATKNFDAANNVGEGDFASVFKGSLSDGTVIAVMLLSSKSKQGNREFVNEIGMISALQHPNPCKVVWMLCWRKPIYACVVYMENNCRSRALFGILPGL CFARERKSFRGG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G07650			Leucine-rich repeat transmembr...		Potri.018G145536 [exp]	0	1
					Potri.015G123750 [exp]	4.24	0.9017
					Potri.017G145400 [exp]	4.47	0.9019
AT3G47090			Leucine-rich repeat protein ki...		Potri.005G030555 [exp]	4.79	0.8077
AT1G77460			Armadillo/beta-catenin-like re...		Potri.002G081101 [exp]	10.00	0.8691
					Potri.010G239500 [exp]	10.90	0.8244
					Potri.017G149301 [exp]	11.22	0.8586
AT3G52360			unknown protein		Potri.016G066200 [exp]	24.65	0.8260
AT3G19540			Protein of unknown function (D...		Potri.009G092400 [exp]	24.79	0.7837
AT5G37290			ARM repeat superfamily protein...		Potri.001G225300 [exp]	26.51	0.8185
AT1G21840		UREF	urease accessory protein F (.1...		Potri.001G224400 [exp]	27.16	0.7155

Compare expression of checked genes

Potri.018G145536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.